Anti GLMN pAb (ATL-HPA031448)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031448-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: GLMN
Alternative Gene Name: FAP48, FKBPAP, GLML, GVM, VMGLOM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029276: 81%, ENSRNOG00000002054: 77%
Entrez Gene ID: 11146
Uniprot ID: Q92990
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LSAIGHPFPKMIFNHGRKKRTWNYLEFEEEENKQLADSMASLAYLVFVQGIHIDQLPMVLSPLYLLQFNMGHIEVFLQRTEESV |
| Gene Sequence | LSAIGHPFPKMIFNHGRKKRTWNYLEFEEEENKQLADSMASLAYLVFVQGIHIDQLPMVLSPLYLLQFNMGHIEVFLQRTEESV |
| Gene ID - Mouse | ENSMUSG00000029276 |
| Gene ID - Rat | ENSRNOG00000002054 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GLMN pAb (ATL-HPA031448) | |
| Datasheet | Anti GLMN pAb (ATL-HPA031448) Datasheet (External Link) |
| Vendor Page | Anti GLMN pAb (ATL-HPA031448) at Atlas Antibodies |
| Documents & Links for Anti GLMN pAb (ATL-HPA031448) | |
| Datasheet | Anti GLMN pAb (ATL-HPA031448) Datasheet (External Link) |
| Vendor Page | Anti GLMN pAb (ATL-HPA031448) |