Anti GLMN pAb (ATL-HPA031448)

Atlas Antibodies

Catalog No.:
ATL-HPA031448-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: glomulin, FKBP associated protein
Gene Name: GLMN
Alternative Gene Name: FAP48, FKBPAP, GLML, GVM, VMGLOM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029276: 81%, ENSRNOG00000002054: 77%
Entrez Gene ID: 11146
Uniprot ID: Q92990
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSAIGHPFPKMIFNHGRKKRTWNYLEFEEEENKQLADSMASLAYLVFVQGIHIDQLPMVLSPLYLLQFNMGHIEVFLQRTEESV
Gene Sequence LSAIGHPFPKMIFNHGRKKRTWNYLEFEEEENKQLADSMASLAYLVFVQGIHIDQLPMVLSPLYLLQFNMGHIEVFLQRTEESV
Gene ID - Mouse ENSMUSG00000029276
Gene ID - Rat ENSRNOG00000002054
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GLMN pAb (ATL-HPA031448)
Datasheet Anti GLMN pAb (ATL-HPA031448) Datasheet (External Link)
Vendor Page Anti GLMN pAb (ATL-HPA031448) at Atlas Antibodies

Documents & Links for Anti GLMN pAb (ATL-HPA031448)
Datasheet Anti GLMN pAb (ATL-HPA031448) Datasheet (External Link)
Vendor Page Anti GLMN pAb (ATL-HPA031448)