Anti GLMN pAb (ATL-HPA031446)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031446-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GLMN
Alternative Gene Name: FAP48, FKBPAP, GLML, GVM, VMGLOM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029276: 83%, ENSRNOG00000002054: 80%
Entrez Gene ID: 11146
Uniprot ID: Q92990
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KLHNKAYSIGLALSTLWNQLSLLPVPYSKEQIQMDDYGLCQCCKALIEFTKPFVEEVIDNKENSLENEKLKDELLKFCFKSLKCPLLTAQFFEQSEEGGN |
Gene Sequence | KLHNKAYSIGLALSTLWNQLSLLPVPYSKEQIQMDDYGLCQCCKALIEFTKPFVEEVIDNKENSLENEKLKDELLKFCFKSLKCPLLTAQFFEQSEEGGN |
Gene ID - Mouse | ENSMUSG00000029276 |
Gene ID - Rat | ENSRNOG00000002054 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GLMN pAb (ATL-HPA031446) | |
Datasheet | Anti GLMN pAb (ATL-HPA031446) Datasheet (External Link) |
Vendor Page | Anti GLMN pAb (ATL-HPA031446) at Atlas Antibodies |
Documents & Links for Anti GLMN pAb (ATL-HPA031446) | |
Datasheet | Anti GLMN pAb (ATL-HPA031446) Datasheet (External Link) |
Vendor Page | Anti GLMN pAb (ATL-HPA031446) |