Anti GLI2 pAb (ATL-HPA074275)

Atlas Antibodies

Catalog No.:
ATL-HPA074275-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: GLI family zinc finger 2
Gene Name: GLI2
Alternative Gene Name: HPE9, THP1, THP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048402: 90%, ENSRNOG00000007261: 95%
Entrez Gene ID: 2736
Uniprot ID: P10070
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PNNDSGVEMPGTGPGSLGDLTALDDTPPGADTSALAAPSAGGLQLRKHMTTMHRFEQLKKEKLKSLKDSCSWA
Gene Sequence PNNDSGVEMPGTGPGSLGDLTALDDTPPGADTSALAAPSAGGLQLRKHMTTMHRFEQLKKEKLKSLKDSCSWA
Gene ID - Mouse ENSMUSG00000048402
Gene ID - Rat ENSRNOG00000007261
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GLI2 pAb (ATL-HPA074275)
Datasheet Anti GLI2 pAb (ATL-HPA074275) Datasheet (External Link)
Vendor Page Anti GLI2 pAb (ATL-HPA074275) at Atlas Antibodies

Documents & Links for Anti GLI2 pAb (ATL-HPA074275)
Datasheet Anti GLI2 pAb (ATL-HPA074275) Datasheet (External Link)
Vendor Page Anti GLI2 pAb (ATL-HPA074275)
Citations for Anti GLI2 pAb (ATL-HPA074275) – 2 Found
Belgacemi, Randa; Luczka, Emilie; Ancel, Julien; Diabasana, Zania; Perotin, Jeanne-Marie; Germain, Adeline; Lalun, Nathalie; Birembaut, Philippe; Dubernard, Xavier; Mérol, Jean-Claude; Delepine, Gonzague; Polette, Myriam; Deslée, Gaëtan; Dormoy, Valérian. Airway epithelial cell differentiation relies on deficient Hedgehog signalling in COPD. Ebiomedicine. 2020;51( 31877414):102572.  PubMed
Ancel, Julien; Belgacemi, Randa; Perotin, Jeanne-Marie; Diabasana, Zania; Dury, Sandra; Dewolf, Maxime; Bonnomet, Arnaud; Lalun, Nathalie; Birembaut, Philippe; Polette, Myriam; Deslée, Gaëtan; Dormoy, Valérian. Sonic hedgehog signalling as a potential endobronchial biomarker in COPD. Respiratory Research. 2020;21(1):207.  PubMed