Anti GLCCI1 pAb (ATL-HPA005987)

Atlas Antibodies

Catalog No.:
ATL-HPA005987-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: glucocorticoid induced transcript 1
Gene Name: GLCCI1
Alternative Gene Name: FAM117C, GIG18, TSSN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029638: 94%, ENSRNOG00000008524: 82%
Entrez Gene ID: 113263
Uniprot ID: Q86VQ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSSPERRSPGSPVCRADKAKSQQVRTSSTIRRTSSLDTITGPYLTGQWPRDPHVHYPSCMKDKATQTPSCWAEEGAEKRSHQRSASWGSADQLKEQIAKLRQQLQRSKQSSRHSKEKDR
Gene Sequence SSSPERRSPGSPVCRADKAKSQQVRTSSTIRRTSSLDTITGPYLTGQWPRDPHVHYPSCMKDKATQTPSCWAEEGAEKRSHQRSASWGSADQLKEQIAKLRQQLQRSKQSSRHSKEKDR
Gene ID - Mouse ENSMUSG00000029638
Gene ID - Rat ENSRNOG00000008524
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GLCCI1 pAb (ATL-HPA005987)
Datasheet Anti GLCCI1 pAb (ATL-HPA005987) Datasheet (External Link)
Vendor Page Anti GLCCI1 pAb (ATL-HPA005987) at Atlas Antibodies

Documents & Links for Anti GLCCI1 pAb (ATL-HPA005987)
Datasheet Anti GLCCI1 pAb (ATL-HPA005987) Datasheet (External Link)
Vendor Page Anti GLCCI1 pAb (ATL-HPA005987)