Anti GKN1 pAb (ATL-HPA047684 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA047684-25

• 

Protein Description: gastrokine 1
Gene Name: GKN1
Alternative Gene Name: AMP18, BRICD1, CA11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030050: 74%, ENSRNOG00000008838: 77%
Entrez Gene ID: 56287
Uniprot ID: Q9NS71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQ
• Gene Sequence: NDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQ
• Gene ID - Mouse: ENSMUSG00000030050
• Gene ID - Rat: ENSRNOG00000008838
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GKN1 pAb (ATL-HPA047684 w/enhanced validation) – 1 Found

Aguilar, Carmen; Pauzuolis, Mindaugas; Pompaiah, Malvika; Vafadarnejad, Ehsan; Arampatzi, Panagiota; Fischer, Mara; Narres, Dominik; Neyazi, Mastura; Kayisoglu, Özge; Sell, Thomas; Blüthgen, Nils; Morkel, Markus; Wiegering, Armin; Germer, Christoph-Thomas; Kircher, Stefan; Rosenwald, Andreas; Saliba, Antoine-Emmanuel; Bartfeld, Sina. Helicobacter pylori shows tropism to gastric differentiated pit cells dependent on urea chemotaxis. Nature Communications. 2022;13(1):5878.