Anti GKN1 pAb (ATL-HPA047684 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047684-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GKN1
Alternative Gene Name: AMP18, BRICD1, CA11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030050: 74%, ENSRNOG00000008838: 77%
Entrez Gene ID: 56287
Uniprot ID: Q9NS71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQ |
| Gene Sequence | NDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQ |
| Gene ID - Mouse | ENSMUSG00000030050 |
| Gene ID - Rat | ENSRNOG00000008838 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GKN1 pAb (ATL-HPA047684 w/enhanced validation) | |
| Datasheet | Anti GKN1 pAb (ATL-HPA047684 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GKN1 pAb (ATL-HPA047684 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti GKN1 pAb (ATL-HPA047684 w/enhanced validation) | |
| Datasheet | Anti GKN1 pAb (ATL-HPA047684 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GKN1 pAb (ATL-HPA047684 w/enhanced validation) |
| Citations for Anti GKN1 pAb (ATL-HPA047684 w/enhanced validation) – 1 Found |
| Aguilar, Carmen; Pauzuolis, Mindaugas; Pompaiah, Malvika; Vafadarnejad, Ehsan; Arampatzi, Panagiota; Fischer, Mara; Narres, Dominik; Neyazi, Mastura; Kayisoglu, Özge; Sell, Thomas; Blüthgen, Nils; Morkel, Markus; Wiegering, Armin; Germer, Christoph-Thomas; Kircher, Stefan; Rosenwald, Andreas; Saliba, Antoine-Emmanuel; Bartfeld, Sina. Helicobacter pylori shows tropism to gastric differentiated pit cells dependent on urea chemotaxis. Nature Communications. 2022;13(1):5878. PubMed |