Anti GKAP1 pAb (ATL-HPA035117)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035117-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GKAP1
Alternative Gene Name: FKSG21, GKAP42
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021552: 93%, ENSRNOG00000019272: 93%
Entrez Gene ID: 80318
Uniprot ID: Q5VSY0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human, Mouse |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ITQWEAKYKEVKARNAQLLKMLQEGEMKDKAEILLQVDESQSIKNELTIQVTSLHAALEQERSKVKVLQAELAKYQGGRKGKRNSESDQCR |
| Gene Sequence | ITQWEAKYKEVKARNAQLLKMLQEGEMKDKAEILLQVDESQSIKNELTIQVTSLHAALEQERSKVKVLQAELAKYQGGRKGKRNSESDQCR |
| Gene ID - Mouse | ENSMUSG00000021552 |
| Gene ID - Rat | ENSRNOG00000019272 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GKAP1 pAb (ATL-HPA035117) | |
| Datasheet | Anti GKAP1 pAb (ATL-HPA035117) Datasheet (External Link) |
| Vendor Page | Anti GKAP1 pAb (ATL-HPA035117) at Atlas Antibodies |
| Documents & Links for Anti GKAP1 pAb (ATL-HPA035117) | |
| Datasheet | Anti GKAP1 pAb (ATL-HPA035117) Datasheet (External Link) |
| Vendor Page | Anti GKAP1 pAb (ATL-HPA035117) |