Anti GK5 pAb (ATL-HPA042606)

Atlas Antibodies

Catalog No.:
ATL-HPA042606-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: glycerol kinase 5 (putative)
Gene Name: GK5
Alternative Gene Name: MGC40579
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041440: 82%, ENSRNOG00000010942: 82%
Entrez Gene ID: 256356
Uniprot ID: Q6ZS86
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NCCFGTIDTWLLYKLTKGSVYATDFSNASTTGLFDPYKMCWSGMITSLISIPLSLLPPVRDTSHNFGSVDEEIFGVPIPIVAL
Gene Sequence NCCFGTIDTWLLYKLTKGSVYATDFSNASTTGLFDPYKMCWSGMITSLISIPLSLLPPVRDTSHNFGSVDEEIFGVPIPIVAL
Gene ID - Mouse ENSMUSG00000041440
Gene ID - Rat ENSRNOG00000010942
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GK5 pAb (ATL-HPA042606)
Datasheet Anti GK5 pAb (ATL-HPA042606) Datasheet (External Link)
Vendor Page Anti GK5 pAb (ATL-HPA042606) at Atlas Antibodies

Documents & Links for Anti GK5 pAb (ATL-HPA042606)
Datasheet Anti GK5 pAb (ATL-HPA042606) Datasheet (External Link)
Vendor Page Anti GK5 pAb (ATL-HPA042606)