Anti GK5 pAb (ATL-HPA042606)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042606-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GK5
Alternative Gene Name: MGC40579
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041440: 82%, ENSRNOG00000010942: 82%
Entrez Gene ID: 256356
Uniprot ID: Q6ZS86
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NCCFGTIDTWLLYKLTKGSVYATDFSNASTTGLFDPYKMCWSGMITSLISIPLSLLPPVRDTSHNFGSVDEEIFGVPIPIVAL |
Gene Sequence | NCCFGTIDTWLLYKLTKGSVYATDFSNASTTGLFDPYKMCWSGMITSLISIPLSLLPPVRDTSHNFGSVDEEIFGVPIPIVAL |
Gene ID - Mouse | ENSMUSG00000041440 |
Gene ID - Rat | ENSRNOG00000010942 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GK5 pAb (ATL-HPA042606) | |
Datasheet | Anti GK5 pAb (ATL-HPA042606) Datasheet (External Link) |
Vendor Page | Anti GK5 pAb (ATL-HPA042606) at Atlas Antibodies |
Documents & Links for Anti GK5 pAb (ATL-HPA042606) | |
Datasheet | Anti GK5 pAb (ATL-HPA042606) Datasheet (External Link) |
Vendor Page | Anti GK5 pAb (ATL-HPA042606) |