Anti GJA8 pAb (ATL-HPA014715 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA014715-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: GJA8
Alternative Gene Name: CAE, CAE1, CX50, CZP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049908: 81%, ENSRNOG00000046703: 82%
Entrez Gene ID: 2703
Uniprot ID: P48165
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SLHSIAVSSIQKAKGYQLLEEEKIVSHYFPLTEVGMVETSPLPAKPFNQFEEKISTGPLGDLSRGYQETLPSYAQVGAQEVEGEGPPAEEGAEPEVGEKKEEAERLTTEEQEKVAVPEGEKVETPGVDKEGEKEEPQSEKVSKQGLP |
| Gene Sequence | SLHSIAVSSIQKAKGYQLLEEEKIVSHYFPLTEVGMVETSPLPAKPFNQFEEKISTGPLGDLSRGYQETLPSYAQVGAQEVEGEGPPAEEGAEPEVGEKKEEAERLTTEEQEKVAVPEGEKVETPGVDKEGEKEEPQSEKVSKQGLP |
| Gene ID - Mouse | ENSMUSG00000049908 |
| Gene ID - Rat | ENSRNOG00000046703 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GJA8 pAb (ATL-HPA014715 w/enhanced validation) | |
| Datasheet | Anti GJA8 pAb (ATL-HPA014715 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GJA8 pAb (ATL-HPA014715 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti GJA8 pAb (ATL-HPA014715 w/enhanced validation) | |
| Datasheet | Anti GJA8 pAb (ATL-HPA014715 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GJA8 pAb (ATL-HPA014715 w/enhanced validation) |