Anti GJA4 pAb (ATL-HPA047981)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047981-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GJA4
Alternative Gene Name: CX37
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050234: 89%, ENSRNOG00000014357: 91%
Entrez Gene ID: 2701
Uniprot ID: P35212
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVASVLCKSVLEAGFLYGQWRLYGWTMEPVFVCQRAPCPYLVDCFVSR |
Gene Sequence | AKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVASVLCKSVLEAGFLYGQWRLYGWTMEPVFVCQRAPCPYLVDCFVSR |
Gene ID - Mouse | ENSMUSG00000050234 |
Gene ID - Rat | ENSRNOG00000014357 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GJA4 pAb (ATL-HPA047981) | |
Datasheet | Anti GJA4 pAb (ATL-HPA047981) Datasheet (External Link) |
Vendor Page | Anti GJA4 pAb (ATL-HPA047981) at Atlas Antibodies |
Documents & Links for Anti GJA4 pAb (ATL-HPA047981) | |
Datasheet | Anti GJA4 pAb (ATL-HPA047981) Datasheet (External Link) |
Vendor Page | Anti GJA4 pAb (ATL-HPA047981) |