Anti GJA4 pAb (ATL-HPA047981)

Atlas Antibodies

Catalog No.: ATL-HPA047981-25

Protein Description: gap junction protein, alpha 4, 37kDa
Gene Name: GJA4
Alternative Gene Name: CX37
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050234: 89%, ENSRNOG00000014357: 91%
Entrez Gene ID: 2701
Uniprot ID: P35212
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVASVLCKSVLEAGFLYGQWRLYGWTMEPVFVCQRAPCPYLVDCFVSR
• Gene Sequence: AKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVASVLCKSVLEAGFLYGQWRLYGWTMEPVFVCQRAPCPYLVDCFVSR
• Gene ID - Mouse: ENSMUSG00000050234
• Gene ID - Rat: ENSRNOG00000014357
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.