Anti GJA3 pAb (ATL-HPA014821)
Atlas Antibodies
- Catalog No.:
- ATL-HPA014821-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: GJA3
Alternative Gene Name: CX46, CZP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048582: 56%, ENSRNOG00000008847: 56%
Entrez Gene ID: 2700
Uniprot ID: Q9Y6H8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MEEKKKEREEEEQLKRESPSPKEPPQDNPSSRDDRGRVRMAG |
| Gene Sequence | MEEKKKEREEEEQLKRESPSPKEPPQDNPSSRDDRGRVRMAG |
| Gene ID - Mouse | ENSMUSG00000048582 |
| Gene ID - Rat | ENSRNOG00000008847 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GJA3 pAb (ATL-HPA014821) | |
| Datasheet | Anti GJA3 pAb (ATL-HPA014821) Datasheet (External Link) |
| Vendor Page | Anti GJA3 pAb (ATL-HPA014821) at Atlas Antibodies |
| Documents & Links for Anti GJA3 pAb (ATL-HPA014821) | |
| Datasheet | Anti GJA3 pAb (ATL-HPA014821) Datasheet (External Link) |
| Vendor Page | Anti GJA3 pAb (ATL-HPA014821) |