Anti GJA3 pAb (ATL-HPA014821)

Atlas Antibodies

Catalog No.:
ATL-HPA014821-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: gap junction protein, alpha 3, 46kDa
Gene Name: GJA3
Alternative Gene Name: CX46, CZP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048582: 56%, ENSRNOG00000008847: 56%
Entrez Gene ID: 2700
Uniprot ID: Q9Y6H8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MEEKKKEREEEEQLKRESPSPKEPPQDNPSSRDDRGRVRMAG
Gene Sequence MEEKKKEREEEEQLKRESPSPKEPPQDNPSSRDDRGRVRMAG
Gene ID - Mouse ENSMUSG00000048582
Gene ID - Rat ENSRNOG00000008847
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GJA3 pAb (ATL-HPA014821)
Datasheet Anti GJA3 pAb (ATL-HPA014821) Datasheet (External Link)
Vendor Page Anti GJA3 pAb (ATL-HPA014821) at Atlas Antibodies

Documents & Links for Anti GJA3 pAb (ATL-HPA014821)
Datasheet Anti GJA3 pAb (ATL-HPA014821) Datasheet (External Link)
Vendor Page Anti GJA3 pAb (ATL-HPA014821)