Anti GJA3 pAb (ATL-HPA014821)

Atlas Antibodies

Catalog No.: ATL-HPA014821-25

Protein Description: gap junction protein, alpha 3, 46kDa
Gene Name: GJA3
Alternative Gene Name: CX46, CZP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048582: 56%, ENSRNOG00000008847: 56%
Entrez Gene ID: 2700
Uniprot ID: Q9Y6H8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEEKKKEREEEEQLKRESPSPKEPPQDNPSSRDDRGRVRMAG
• Gene Sequence: MEEKKKEREEEEQLKRESPSPKEPPQDNPSSRDDRGRVRMAG
• Gene ID - Mouse: ENSMUSG00000048582
• Gene ID - Rat: ENSRNOG00000008847
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.