Anti GJA1 pAb (ATL-HPA035097 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA035097-25

Protein Description: gap junction protein, alpha 1, 43kDa
Gene Name: GJA1
Alternative Gene Name: CX43, GJAL, ODD, ODDD, ODOD, SDTY3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050953: 96%, ENSRNOG00000000805: 97%
Entrez Gene ID: 2697
Uniprot ID: P17302
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPR
• Gene Sequence: EQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPR
• Gene ID - Mouse: ENSMUSG00000050953
• Gene ID - Rat: ENSRNOG00000000805
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GJA1 pAb (ATL-HPA035097 w/enhanced validation) – 1 Found

Lapoirie, Marion; Dijoud, Frederique; Lejeune, Hervé; Plotton, Ingrid. Effect of androgens on Sertoli cell maturation in human testis from birth to puberty. Basic And Clinical Andrology. 2021;31(1):31.