Anti GIT1 pAb (ATL-HPA004186)

Atlas Antibodies

Catalog No.: ATL-HPA004186-25

Protein Description: G protein-coupled receptor kinase interacting ArfGAP 1
Gene Name: GIT1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011877: 94%, ENSRNOG00000061270: 94%
Entrez Gene ID: 28964
Uniprot ID: Q9Y2X7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DLDDQHDYDSVASDEDTDQEPLRSTGATRSNRARSMDSSDLSDGAVTLQEYLELKKALATSEAKVQQLMKVSSSLSDELRRLQREIHKLQAENLQLRQPPGPVPTPPLPSERAEHTPMAPGGSTHRRDRQAFSMYEPGSAL
• Gene Sequence: DLDDQHDYDSVASDEDTDQEPLRSTGATRSNRARSMDSSDLSDGAVTLQEYLELKKALATSEAKVQQLMKVSSSLSDELRRLQREIHKLQAENLQLRQPPGPVPTPPLPSERAEHTPMAPGGSTHRRDRQAFSMYEPGSAL
• Gene ID - Mouse: ENSMUSG00000011877
• Gene ID - Rat: ENSRNOG00000061270
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.