Anti GINS4 pAb (ATL-HPA024663 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA024663-100

Protein Description: GINS complex subunit 4 (Sld5 homolog)
Gene Name: GINS4
Alternative Gene Name: MGC14799, SLD5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031546: 89%, ENSRNOG00000018040: 89%
Entrez Gene ID: 84296
Uniprot ID: Q9BRT9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MTEEVDFLGQDSDGGSEEVVLTPAELIERLEQAWMNEKFAPELLESKPEIVECVMEQLEHMEE
• Gene Sequence: MTEEVDFLGQDSDGGSEEVVLTPAELIERLEQAWMNEKFAPELLESKPEIVECVMEQLEHMEE
• Gene ID - Mouse: ENSMUSG00000031546
• Gene ID - Rat: ENSRNOG00000018040
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GINS4 pAb (ATL-HPA024663 w/enhanced validation) – 1 Found

Kaur, Manpreet; Devi, Raksha; Ghosh, Tanushree; Khan, Md Muntaz; Kumar, Praveen; Priyanka; Kar, Ananya; Sharma, Aparna; Varshney, Akhil; Kumar, Vipin; Saxena, Sandeep. Sld5 Ensures Centrosomal Resistance to Congression Forces by Preserving Centriolar Satellites. Molecular And Cellular Biology. 2018;38(2)