Anti GINS4 pAb (ATL-HPA024663 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
 - ATL-HPA024663-100
 
- Shipping:
 - Calculated at Checkout
 
        
            
        
        
        $596.00
    
         
                            Gene Name: GINS4
Alternative Gene Name: MGC14799, SLD5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031546: 89%, ENSRNOG00000018040: 89%
Entrez Gene ID: 84296
Uniprot ID: Q9BRT9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC | 
| Reactivity | Human | 
| Clonality | Polyclonal | 
| Host | Rabbit | 
| Immunogen | MTEEVDFLGQDSDGGSEEVVLTPAELIERLEQAWMNEKFAPELLESKPEIVECVMEQLEHMEE | 
| Gene Sequence | MTEEVDFLGQDSDGGSEEVVLTPAELIERLEQAWMNEKFAPELLESKPEIVECVMEQLEHMEE | 
| Gene ID - Mouse | ENSMUSG00000031546 | 
| Gene ID - Rat | ENSRNOG00000018040 | 
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. | 
| Documents & Links for Anti GINS4 pAb (ATL-HPA024663 w/enhanced validation) | |
| Datasheet | Anti GINS4 pAb (ATL-HPA024663 w/enhanced validation) Datasheet (External Link) | 
| Vendor Page | Anti GINS4 pAb (ATL-HPA024663 w/enhanced validation) at Atlas Antibodies | 
| Documents & Links for Anti GINS4 pAb (ATL-HPA024663 w/enhanced validation) | |
| Datasheet | Anti GINS4 pAb (ATL-HPA024663 w/enhanced validation) Datasheet (External Link) | 
| Vendor Page | Anti GINS4 pAb (ATL-HPA024663 w/enhanced validation) | 
| Citations for Anti GINS4 pAb (ATL-HPA024663 w/enhanced validation) – 1 Found | 
| Kaur, Manpreet; Devi, Raksha; Ghosh, Tanushree; Khan, Md Muntaz; Kumar, Praveen; Priyanka; Kar, Ananya; Sharma, Aparna; Varshney, Akhil; Kumar, Vipin; Saxena, Sandeep. Sld5 Ensures Centrosomal Resistance to Congression Forces by Preserving Centriolar Satellites. Molecular And Cellular Biology. 2018;38(2) PubMed |