Anti GINM1 pAb (ATL-HPA041679)

Atlas Antibodies

Catalog No.:
ATL-HPA041679-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: glycoprotein integral membrane 1
Gene Name: GINM1
Alternative Gene Name: C6orf72, dJ12G14.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040006: 82%, ENSRNOG00000015239: 75%
Entrez Gene ID: 116254
Uniprot ID: Q9NU53
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QKDVTEIDILVKNRGVLRHSNYTLPLEESMLYSISRDSDILFTLPNLSKKESVSSLQTTSQYLIRNVETTVDEDVLPGKLPETPLRAEPPSSYKVMCQWMEKFRKDLCRFWSN
Gene Sequence QKDVTEIDILVKNRGVLRHSNYTLPLEESMLYSISRDSDILFTLPNLSKKESVSSLQTTSQYLIRNVETTVDEDVLPGKLPETPLRAEPPSSYKVMCQWMEKFRKDLCRFWSN
Gene ID - Mouse ENSMUSG00000040006
Gene ID - Rat ENSRNOG00000015239
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GINM1 pAb (ATL-HPA041679)
Datasheet Anti GINM1 pAb (ATL-HPA041679) Datasheet (External Link)
Vendor Page Anti GINM1 pAb (ATL-HPA041679) at Atlas Antibodies

Documents & Links for Anti GINM1 pAb (ATL-HPA041679)
Datasheet Anti GINM1 pAb (ATL-HPA041679) Datasheet (External Link)
Vendor Page Anti GINM1 pAb (ATL-HPA041679)