Anti GIN1 pAb (ATL-HPA037402)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037402-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: GIN1
Alternative Gene Name: FLJ20125, GIN-1, TGIN1, ZH2C2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026333: 94%, ENSRNOG00000011962: 93%
Entrez Gene ID: 54826
Uniprot ID: Q9NXP7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NGDLHLKQIAYYKRTGEYHSTTLPSERSGIRRAAKKFVFKEKKLFYVGKDRKQNRLVIVSEEEKKKVLRECHENDSGAHHGISRTLT |
| Gene Sequence | NGDLHLKQIAYYKRTGEYHSTTLPSERSGIRRAAKKFVFKEKKLFYVGKDRKQNRLVIVSEEEKKKVLRECHENDSGAHHGISRTLT |
| Gene ID - Mouse | ENSMUSG00000026333 |
| Gene ID - Rat | ENSRNOG00000011962 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GIN1 pAb (ATL-HPA037402) | |
| Datasheet | Anti GIN1 pAb (ATL-HPA037402) Datasheet (External Link) |
| Vendor Page | Anti GIN1 pAb (ATL-HPA037402) at Atlas Antibodies |
| Documents & Links for Anti GIN1 pAb (ATL-HPA037402) | |
| Datasheet | Anti GIN1 pAb (ATL-HPA037402) Datasheet (External Link) |
| Vendor Page | Anti GIN1 pAb (ATL-HPA037402) |