Anti GIN1 pAb (ATL-HPA037402)

Atlas Antibodies

SKU: ATL-HPA037402-25

• 

Protein Description: gypsy retrotransposon integrase 1
Gene Name: GIN1
Alternative Gene Name: FLJ20125, GIN-1, TGIN1, ZH2C2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026333: 94%, ENSRNOG00000011962: 93%
Entrez Gene ID: 54826
Uniprot ID: Q9NXP7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NGDLHLKQIAYYKRTGEYHSTTLPSERSGIRRAAKKFVFKEKKLFYVGKDRKQNRLVIVSEEEKKKVLRECHENDSGAHHGISRTLT
• Gene Sequence: NGDLHLKQIAYYKRTGEYHSTTLPSERSGIRRAAKKFVFKEKKLFYVGKDRKQNRLVIVSEEEKKKVLRECHENDSGAHHGISRTLT
• Gene ID - Mouse: ENSMUSG00000026333
• Gene ID - Rat: ENSRNOG00000011962
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.