Anti GIMAP6 pAb (ATL-HPA026715)

Atlas Antibodies

Catalog No.: ATL-HPA026715-25

Protein Description: GTPase, IMAP family member 6
Gene Name: GIMAP6
Alternative Gene Name: FLJ22690, IAN6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047867: 60%, ENSRNOG00000033338: 64%
Entrez Gene ID: 474344
Uniprot ID: Q6P9H5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEEEEYEQIPQENPPEELSQDPVLELSGGLREKEQKTPRRLRLILMGKTGSGKSATGNSILGRDVFESKLSTRPVTK
• Gene Sequence: MEEEEYEQIPQENPPEELSQDPVLELSGGLREKEQKTPRRLRLILMGKTGSGKSATGNSILGRDVFESKLSTRPVTK
• Gene ID - Mouse: ENSMUSG00000047867
• Gene ID - Rat: ENSRNOG00000033338
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.