Anti GIMAP6 pAb (ATL-HPA026715)

Atlas Antibodies

Catalog No.:
ATL-HPA026715-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: GTPase, IMAP family member 6
Gene Name: GIMAP6
Alternative Gene Name: FLJ22690, IAN6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047867: 60%, ENSRNOG00000033338: 64%
Entrez Gene ID: 474344
Uniprot ID: Q6P9H5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MEEEEYEQIPQENPPEELSQDPVLELSGGLREKEQKTPRRLRLILMGKTGSGKSATGNSILGRDVFESKLSTRPVTK
Gene Sequence MEEEEYEQIPQENPPEELSQDPVLELSGGLREKEQKTPRRLRLILMGKTGSGKSATGNSILGRDVFESKLSTRPVTK
Gene ID - Mouse ENSMUSG00000047867
Gene ID - Rat ENSRNOG00000033338
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GIMAP6 pAb (ATL-HPA026715)
Datasheet Anti GIMAP6 pAb (ATL-HPA026715) Datasheet (External Link)
Vendor Page Anti GIMAP6 pAb (ATL-HPA026715) at Atlas Antibodies

Documents & Links for Anti GIMAP6 pAb (ATL-HPA026715)
Datasheet Anti GIMAP6 pAb (ATL-HPA026715) Datasheet (External Link)
Vendor Page Anti GIMAP6 pAb (ATL-HPA026715)