Anti GIGYF1 pAb (ATL-HPA023995)

Atlas Antibodies

SKU:
ATL-HPA023995-25
  • Immunohistochemical staining of human kidney shows strong nuclear and cytoplasmic positivity in tubular and glomeruli cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: GRB10 interacting GYF protein 1
Gene Name: GIGYF1
Alternative Gene Name: GYF1, PERQ1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029714: 91%, ENSRNOG00000001410: 90%
Entrez Gene ID: 64599
Uniprot ID: O75420
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GIQLSPGVGSSAGPPGDLEDDEGLKHLQQEAEKLVASLQDSSLEEEQFTAAMQTQGLRHSAAATALPLSHGAARKWFYKDPQGEIQGPFTTQEMAEWF
Gene Sequence GIQLSPGVGSSAGPPGDLEDDEGLKHLQQEAEKLVASLQDSSLEEEQFTAAMQTQGLRHSAAATALPLSHGAARKWFYKDPQGEIQGPFTTQEMAEWF
Gene ID - Mouse ENSMUSG00000029714
Gene ID - Rat ENSRNOG00000001410
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GIGYF1 pAb (ATL-HPA023995)
Datasheet Anti GIGYF1 pAb (ATL-HPA023995) Datasheet (External Link)
Vendor Page Anti GIGYF1 pAb (ATL-HPA023995) at Atlas Antibodies

Documents & Links for Anti GIGYF1 pAb (ATL-HPA023995)
Datasheet Anti GIGYF1 pAb (ATL-HPA023995) Datasheet (External Link)
Vendor Page Anti GIGYF1 pAb (ATL-HPA023995)