Anti GIGYF1 pAb (ATL-HPA020999)

Atlas Antibodies

SKU: ATL-HPA020999-25

• 
• 

Protein Description: GRB10 interacting GYF protein 1
Gene Name: GIGYF1
Alternative Gene Name: GYF1, PERQ1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029714: 89%, ENSRNOG00000001410: 86%
Entrez Gene ID: 64599
Uniprot ID: O75420
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DTLEAKEFAKQFLERRAKQKASQQRQQQQEAWLSSASLQTAFQANHSTKLGPGEGSKAKRRALMLHSDPSILGYSL
• Gene Sequence: DTLEAKEFAKQFLERRAKQKASQQRQQQQEAWLSSASLQTAFQANHSTKLGPGEGSKAKRRALMLHSDPSILGYSL
• Gene ID - Mouse: ENSMUSG00000029714
• Gene ID - Rat: ENSRNOG00000001410
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.