Anti GIGYF1 pAb (ATL-HPA020999)
Atlas Antibodies
- Catalog No.:
- ATL-HPA020999-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: GIGYF1
Alternative Gene Name: GYF1, PERQ1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029714: 89%, ENSRNOG00000001410: 86%
Entrez Gene ID: 64599
Uniprot ID: O75420
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DTLEAKEFAKQFLERRAKQKASQQRQQQQEAWLSSASLQTAFQANHSTKLGPGEGSKAKRRALMLHSDPSILGYSL |
| Gene Sequence | DTLEAKEFAKQFLERRAKQKASQQRQQQQEAWLSSASLQTAFQANHSTKLGPGEGSKAKRRALMLHSDPSILGYSL |
| Gene ID - Mouse | ENSMUSG00000029714 |
| Gene ID - Rat | ENSRNOG00000001410 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GIGYF1 pAb (ATL-HPA020999) | |
| Datasheet | Anti GIGYF1 pAb (ATL-HPA020999) Datasheet (External Link) |
| Vendor Page | Anti GIGYF1 pAb (ATL-HPA020999) at Atlas Antibodies |
| Documents & Links for Anti GIGYF1 pAb (ATL-HPA020999) | |
| Datasheet | Anti GIGYF1 pAb (ATL-HPA020999) Datasheet (External Link) |
| Vendor Page | Anti GIGYF1 pAb (ATL-HPA020999) |