Anti GIF pAb (ATL-HPA040774 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040774-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: GIF
Alternative Gene Name: IF, IFMH, INF, TCN3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024682: 80%, ENSRNOG00000021001: 78%
Entrez Gene ID: 2694
Uniprot ID: P27352
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDHEVQPTLPSNP |
| Gene Sequence | LFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDHEVQPTLPSNP |
| Gene ID - Mouse | ENSMUSG00000024682 |
| Gene ID - Rat | ENSRNOG00000021001 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GIF pAb (ATL-HPA040774 w/enhanced validation) | |
| Datasheet | Anti GIF pAb (ATL-HPA040774 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GIF pAb (ATL-HPA040774 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti GIF pAb (ATL-HPA040774 w/enhanced validation) | |
| Datasheet | Anti GIF pAb (ATL-HPA040774 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GIF pAb (ATL-HPA040774 w/enhanced validation) |
| Citations for Anti GIF pAb (ATL-HPA040774 w/enhanced validation) – 3 Found |
| McCracken, Kyle W; Aihara, Eitaro; Martin, Baptiste; Crawford, Calyn M; Broda, Taylor; Treguier, Julie; Zhang, Xinghao; Shannon, John M; Montrose, Marshall H; Wells, James M. Wnt/β-catenin promotes gastric fundus specification in mice and humans. Nature. 2017;541(7636):182-187. PubMed |
| Lee, Ji-Hyun; Kim, Somi; Han, Seungmin; Min, Jimin; Caldwell, Brianna; Bamford, Aileen-Diane; Rocha, Andreia Sofia Batista; Park, JinYoung; Lee, Sieun; Wu, Szu-Hsien Sam; Lee, Heetak; Fink, Juergen; Pilat-Carotta, Sandra; Kim, Jihoon; Josserand, Manon; Szep-Bakonyi, Réka; An, Yohan; Ju, Young Seok; Philpott, Anna; Simons, Benjamin D; Stange, Daniel E; Choi, Eunyoung; Koo, Bon-Kyoung; Kim, Jong Kyoung. p57(Kip2) imposes the reserve stem cell state of gastric chief cells. Cell Stem Cell. 2022;29(5):826-839.e9. PubMed |
| Puri, Pawan; Grimmett, Garfield; Faraj, Rawah; Gibson, Laurielle; Gilbreath, Ebony; Yoder, Bradley K. Elevated Protein Kinase A Activity in Stomach Mesenchyme Disrupts Mesenchymal-epithelial Crosstalk and Induces Preneoplasia. Cellular And Molecular Gastroenterology And Hepatology. 14(3):643-668.e1. PubMed |