Anti GIF pAb (ATL-HPA040774 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA040774-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: gastric intrinsic factor (vitamin B synthesis)
Gene Name: GIF
Alternative Gene Name: IF, IFMH, INF, TCN3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024682: 80%, ENSRNOG00000021001: 78%
Entrez Gene ID: 2694
Uniprot ID: P27352
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDHEVQPTLPSNP
Gene Sequence LFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDHEVQPTLPSNP
Gene ID - Mouse ENSMUSG00000024682
Gene ID - Rat ENSRNOG00000021001
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GIF pAb (ATL-HPA040774 w/enhanced validation)
Datasheet Anti GIF pAb (ATL-HPA040774 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GIF pAb (ATL-HPA040774 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GIF pAb (ATL-HPA040774 w/enhanced validation)
Datasheet Anti GIF pAb (ATL-HPA040774 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GIF pAb (ATL-HPA040774 w/enhanced validation)
Citations for Anti GIF pAb (ATL-HPA040774 w/enhanced validation) – 3 Found
McCracken, Kyle W; Aihara, Eitaro; Martin, Baptiste; Crawford, Calyn M; Broda, Taylor; Treguier, Julie; Zhang, Xinghao; Shannon, John M; Montrose, Marshall H; Wells, James M. Wnt/β-catenin promotes gastric fundus specification in mice and humans. Nature. 2017;541(7636):182-187.  PubMed
Lee, Ji-Hyun; Kim, Somi; Han, Seungmin; Min, Jimin; Caldwell, Brianna; Bamford, Aileen-Diane; Rocha, Andreia Sofia Batista; Park, JinYoung; Lee, Sieun; Wu, Szu-Hsien Sam; Lee, Heetak; Fink, Juergen; Pilat-Carotta, Sandra; Kim, Jihoon; Josserand, Manon; Szep-Bakonyi, Réka; An, Yohan; Ju, Young Seok; Philpott, Anna; Simons, Benjamin D; Stange, Daniel E; Choi, Eunyoung; Koo, Bon-Kyoung; Kim, Jong Kyoung. p57(Kip2) imposes the reserve stem cell state of gastric chief cells. Cell Stem Cell. 2022;29(5):826-839.e9.  PubMed
Puri, Pawan; Grimmett, Garfield; Faraj, Rawah; Gibson, Laurielle; Gilbreath, Ebony; Yoder, Bradley K. Elevated Protein Kinase A Activity in Stomach Mesenchyme Disrupts Mesenchymal-epithelial Crosstalk and Induces Preneoplasia. Cellular And Molecular Gastroenterology And Hepatology. 14(3):643-668.e1.  PubMed