Anti GID4 pAb (ATL-HPA044348)

Atlas Antibodies

Catalog No.:
ATL-HPA044348-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: GID complex subunit 4
Gene Name: GID4
Alternative Gene Name: C17orf39, VID24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018415: 100%, ENSRNOG00000003847: 100%
Entrez Gene ID: 79018
Uniprot ID: Q8IVV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYE
Gene Sequence DTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYE
Gene ID - Mouse ENSMUSG00000018415
Gene ID - Rat ENSRNOG00000003847
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GID4 pAb (ATL-HPA044348)
Datasheet Anti GID4 pAb (ATL-HPA044348) Datasheet (External Link)
Vendor Page Anti GID4 pAb (ATL-HPA044348) at Atlas Antibodies

Documents & Links for Anti GID4 pAb (ATL-HPA044348)
Datasheet Anti GID4 pAb (ATL-HPA044348) Datasheet (External Link)
Vendor Page Anti GID4 pAb (ATL-HPA044348)