Anti GID4 pAb (ATL-HPA044348)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044348-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GID4
Alternative Gene Name: C17orf39, VID24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018415: 100%, ENSRNOG00000003847: 100%
Entrez Gene ID: 79018
Uniprot ID: Q8IVV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYE |
Gene Sequence | DTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYE |
Gene ID - Mouse | ENSMUSG00000018415 |
Gene ID - Rat | ENSRNOG00000003847 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GID4 pAb (ATL-HPA044348) | |
Datasheet | Anti GID4 pAb (ATL-HPA044348) Datasheet (External Link) |
Vendor Page | Anti GID4 pAb (ATL-HPA044348) at Atlas Antibodies |
Documents & Links for Anti GID4 pAb (ATL-HPA044348) | |
Datasheet | Anti GID4 pAb (ATL-HPA044348) Datasheet (External Link) |
Vendor Page | Anti GID4 pAb (ATL-HPA044348) |