Anti GHRL pAb (ATL-HPA014246 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA014246-25
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: ghrelin/obestatin prepropeptide
Gene Name: GHRL
Alternative Gene Name: ghrelin, MTLRP, obestatin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064177: 84%, ENSRNOG00000010349: 86%
Entrez Gene ID: 51738
Uniprot ID: Q9UBU3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHS
Gene Sequence RKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHS
Gene ID - Mouse ENSMUSG00000064177
Gene ID - Rat ENSRNOG00000010349
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GHRL pAb (ATL-HPA014246 w/enhanced validation)
Datasheet Anti GHRL pAb (ATL-HPA014246 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GHRL pAb (ATL-HPA014246 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GHRL pAb (ATL-HPA014246 w/enhanced validation)
Datasheet Anti GHRL pAb (ATL-HPA014246 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GHRL pAb (ATL-HPA014246 w/enhanced validation)