Anti GHRL pAb (ATL-HPA014246 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA014246-25

Protein Description: ghrelin/obestatin prepropeptide
Gene Name: GHRL
Alternative Gene Name: ghrelin, MTLRP, obestatin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064177: 84%, ENSRNOG00000010349: 86%
Entrez Gene ID: 51738
Uniprot ID: Q9UBU3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHS
• Gene Sequence: RKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHS
• Gene ID - Mouse: ENSMUSG00000064177
• Gene ID - Rat: ENSRNOG00000010349
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.