Anti GHR pAb (ATL-HPA045339 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA045339-25

Protein Description: growth hormone receptor
Gene Name: GHR
Alternative Gene Name: GHBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055737: 66%, ENSRNOG00000015654: 68%
Entrez Gene ID: 2690
Uniprot ID: P10912
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQF
• Gene Sequence: NWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQF
• Gene ID - Mouse: ENSMUSG00000055737
• Gene ID - Rat: ENSRNOG00000015654
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.