Anti GHITM pAb (ATL-HPA016464)

Atlas Antibodies

SKU: ATL-HPA016464-25

• 

Protein Description: growth hormone inducible transmembrane protein
Gene Name: GHITM
Alternative Gene Name: DERP2, HSPC282, My021, PTD010, TMBIM5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041028: 90%, ENSRNOG00000013961: 87%
Entrez Gene ID: 27069
Uniprot ID: Q9H3K2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DTQKVIKRAEVSPMYGVQKYDPINSMLSIYMDTLNIFMRVATMLATGGNRKK
• Gene Sequence: DTQKVIKRAEVSPMYGVQKYDPINSMLSIYMDTLNIFMRVATMLATGGNRKK
• Gene ID - Mouse: ENSMUSG00000041028
• Gene ID - Rat: ENSRNOG00000013961
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.