Anti GHITM pAb (ATL-HPA016464)
Atlas Antibodies
- Catalog No.:
- ATL-HPA016464-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GHITM
Alternative Gene Name: DERP2, HSPC282, My021, PTD010, TMBIM5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041028: 90%, ENSRNOG00000013961: 87%
Entrez Gene ID: 27069
Uniprot ID: Q9H3K2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DTQKVIKRAEVSPMYGVQKYDPINSMLSIYMDTLNIFMRVATMLATGGNRKK |
| Gene Sequence | DTQKVIKRAEVSPMYGVQKYDPINSMLSIYMDTLNIFMRVATMLATGGNRKK |
| Gene ID - Mouse | ENSMUSG00000041028 |
| Gene ID - Rat | ENSRNOG00000013961 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GHITM pAb (ATL-HPA016464) | |
| Datasheet | Anti GHITM pAb (ATL-HPA016464) Datasheet (External Link) |
| Vendor Page | Anti GHITM pAb (ATL-HPA016464) at Atlas Antibodies |
| Documents & Links for Anti GHITM pAb (ATL-HPA016464) | |
| Datasheet | Anti GHITM pAb (ATL-HPA016464) Datasheet (External Link) |
| Vendor Page | Anti GHITM pAb (ATL-HPA016464) |