Anti GHDC pAb (ATL-HPA031650)

Atlas Antibodies

SKU:
ATL-HPA031650-100
  • Immunohistochemical staining of human cerebral cortex shows strong granular cytoplasmic positivity in neurons.
  • Western blot analysis in human cell line SK-BR-3.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: GH3 domain containing
Gene Name: GHDC
Alternative Gene Name: LGP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017747: 78%, ENSRNOG00000018906: 86%
Entrez Gene ID: 84514
Uniprot ID: Q8N2G8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SAPHYEVFVALRGLRNLSEENRDKLDHCLQEASPRYKSLRFWGSVGPARVHLVGQGAFRALRAALAACPSSPFPPAMPRVLRHRHLAQCL
Gene Sequence SAPHYEVFVALRGLRNLSEENRDKLDHCLQEASPRYKSLRFWGSVGPARVHLVGQGAFRALRAALAACPSSPFPPAMPRVLRHRHLAQCL
Gene ID - Mouse ENSMUSG00000017747
Gene ID - Rat ENSRNOG00000018906
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GHDC pAb (ATL-HPA031650)
Datasheet Anti GHDC pAb (ATL-HPA031650) Datasheet (External Link)
Vendor Page Anti GHDC pAb (ATL-HPA031650) at Atlas Antibodies

Documents & Links for Anti GHDC pAb (ATL-HPA031650)
Datasheet Anti GHDC pAb (ATL-HPA031650) Datasheet (External Link)
Vendor Page Anti GHDC pAb (ATL-HPA031650)