Anti GGT7 pAb (ATL-HPA013204)

Atlas Antibodies

Catalog No.:
ATL-HPA013204-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: gamma-glutamyltransferase 7
Gene Name: GGT7
Alternative Gene Name: D20S101, dJ18C9.2, GGTL3, GGTL5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027603: 96%, ENSRNOG00000018441: 95%
Entrez Gene ID: 2686
Uniprot ID: Q9UJ14
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen HLVLSPPPPHTGPALISALNILEGFNLTSLVSREQALHWVAETLKIALALASRLGDPVYDSTITESMDDMLSKVEAAYLRGHINDSQAAPAPLLPVYELDGAPTAAQVLIMGPDDFIVAMVSSLNQPFGSGLITPSGILLNS
Gene Sequence HLVLSPPPPHTGPALISALNILEGFNLTSLVSREQALHWVAETLKIALALASRLGDPVYDSTITESMDDMLSKVEAAYLRGHINDSQAAPAPLLPVYELDGAPTAAQVLIMGPDDFIVAMVSSLNQPFGSGLITPSGILLNS
Gene ID - Mouse ENSMUSG00000027603
Gene ID - Rat ENSRNOG00000018441
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GGT7 pAb (ATL-HPA013204)
Datasheet Anti GGT7 pAb (ATL-HPA013204) Datasheet (External Link)
Vendor Page Anti GGT7 pAb (ATL-HPA013204) at Atlas Antibodies

Documents & Links for Anti GGT7 pAb (ATL-HPA013204)
Datasheet Anti GGT7 pAb (ATL-HPA013204) Datasheet (External Link)
Vendor Page Anti GGT7 pAb (ATL-HPA013204)
Citations for Anti GGT7 pAb (ATL-HPA013204) – 1 Found
Grimm, C; Hofstetter, G; Aust, S; Mutz-Dehbalaie, I; Bruch, M; Heinze, G; Rahhal-Schupp, J; Reinthaller, A; Concin, N; Polterauer, S. Association of gamma-glutamyltransferase with severity of disease at diagnosis and prognosis of ovarian cancer. British Journal Of Cancer. 2013;109(3):610-4.  PubMed