Anti GGNBP2 pAb (ATL-HPA018914)

Atlas Antibodies

SKU: ATL-HPA018914-25

• 

Protein Description: gametogenetin binding protein 2
Gene Name: GGNBP2
Alternative Gene Name: DIF-3, DIF3, FLJ21230, FLJ22561, LZK1, ZFP403, ZNF403
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020530: 100%, ENSRNOG00000027860: 100%
Entrez Gene ID: 79893
Uniprot ID: Q9H3C7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLRAYNILIGELDCSKEKGYCAALYEGLRCCPHERHIHVCCETDFIAHLLGRAEPEFAGGRRERHAKTIDIAQEEVLTCLGIHLYERLHRIWQKLRAE
• Gene Sequence: VLRAYNILIGELDCSKEKGYCAALYEGLRCCPHERHIHVCCETDFIAHLLGRAEPEFAGGRRERHAKTIDIAQEEVLTCLGIHLYERLHRIWQKLRAE
• Gene ID - Mouse: ENSMUSG00000020530
• Gene ID - Rat: ENSRNOG00000027860
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.