Anti GGCX pAb (ATL-HPA018284)
Atlas Antibodies
- SKU:
- ATL-HPA018284-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GGCX
Alternative Gene Name: VKCFD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000103019: 96%, ENSRNOG00000012975: 97%
Entrez Gene ID: 2677
Uniprot ID: P38435
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FPGLHLENFVSEDLGNTSIQLLQGEVTVELVAEQKNQTLREGEKMQLPAGEYHKVYTTSPSPSCYMYVYVNTTELALEQDLAYLQELKEKVENGSETGPLPPELQPLLEGEVK |
Gene Sequence | FPGLHLENFVSEDLGNTSIQLLQGEVTVELVAEQKNQTLREGEKMQLPAGEYHKVYTTSPSPSCYMYVYVNTTELALEQDLAYLQELKEKVENGSETGPLPPELQPLLEGEVK |
Gene ID - Mouse | ENSMUSG00000103019 |
Gene ID - Rat | ENSRNOG00000012975 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GGCX pAb (ATL-HPA018284) | |
Datasheet | Anti GGCX pAb (ATL-HPA018284) Datasheet (External Link) |
Vendor Page | Anti GGCX pAb (ATL-HPA018284) at Atlas Antibodies |
Documents & Links for Anti GGCX pAb (ATL-HPA018284) | |
Datasheet | Anti GGCX pAb (ATL-HPA018284) Datasheet (External Link) |
Vendor Page | Anti GGCX pAb (ATL-HPA018284) |
Citations for Anti GGCX pAb (ATL-HPA018284) – 1 Found |
Beaudin, Sarah; Kokabee, Leila; Welsh, JoEllen. Divergent effects of vitamins K1 and K2 on triple negative breast cancer cells. Oncotarget. 2019;10(23):2292-2305. PubMed |