Anti GGCX pAb (ATL-HPA018284)

Atlas Antibodies

Catalog No.:
ATL-HPA018284-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: gamma-glutamyl carboxylase
Gene Name: GGCX
Alternative Gene Name: VKCFD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000103019: 96%, ENSRNOG00000012975: 97%
Entrez Gene ID: 2677
Uniprot ID: P38435
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FPGLHLENFVSEDLGNTSIQLLQGEVTVELVAEQKNQTLREGEKMQLPAGEYHKVYTTSPSPSCYMYVYVNTTELALEQDLAYLQELKEKVENGSETGPLPPELQPLLEGEVK
Gene Sequence FPGLHLENFVSEDLGNTSIQLLQGEVTVELVAEQKNQTLREGEKMQLPAGEYHKVYTTSPSPSCYMYVYVNTTELALEQDLAYLQELKEKVENGSETGPLPPELQPLLEGEVK
Gene ID - Mouse ENSMUSG00000103019
Gene ID - Rat ENSRNOG00000012975
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GGCX pAb (ATL-HPA018284)
Datasheet Anti GGCX pAb (ATL-HPA018284) Datasheet (External Link)
Vendor Page Anti GGCX pAb (ATL-HPA018284) at Atlas Antibodies

Documents & Links for Anti GGCX pAb (ATL-HPA018284)
Datasheet Anti GGCX pAb (ATL-HPA018284) Datasheet (External Link)
Vendor Page Anti GGCX pAb (ATL-HPA018284)
Citations for Anti GGCX pAb (ATL-HPA018284) – 1 Found
Beaudin, Sarah; Kokabee, Leila; Welsh, JoEllen. Divergent effects of vitamins K1 and K2 on triple negative breast cancer cells. Oncotarget. 2019;10(23):2292-2305.  PubMed