Anti GGA3 pAb (ATL-HPA022945)

Atlas Antibodies

Catalog No.:
ATL-HPA022945-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: golgi-associated, gamma adaptin ear containing, ARF binding protein 3
Gene Name: GGA3
Alternative Gene Name: KIAA0154
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020740: 63%, ENSRNOG00000027057: 58%
Entrez Gene ID: 23163
Uniprot ID: Q9NZ52
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LDFFSPRPGTAACGASDAPLLQPSAPSSSSSQAPLPPPFPAPVVPASVPAPSAGSSLFSTGVAPALAPKVEPAVPGHH
Gene Sequence LDFFSPRPGTAACGASDAPLLQPSAPSSSSSQAPLPPPFPAPVVPASVPAPSAGSSLFSTGVAPALAPKVEPAVPGHH
Gene ID - Mouse ENSMUSG00000020740
Gene ID - Rat ENSRNOG00000027057
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GGA3 pAb (ATL-HPA022945)
Datasheet Anti GGA3 pAb (ATL-HPA022945) Datasheet (External Link)
Vendor Page Anti GGA3 pAb (ATL-HPA022945) at Atlas Antibodies

Documents & Links for Anti GGA3 pAb (ATL-HPA022945)
Datasheet Anti GGA3 pAb (ATL-HPA022945) Datasheet (External Link)
Vendor Page Anti GGA3 pAb (ATL-HPA022945)