Anti GFRA2 pAb (ATL-HPA024704)

Atlas Antibodies

SKU: ATL-HPA024704-25

• 
• 

Protein Description: GDNF family receptor alpha 2
Gene Name: GFRA2
Alternative Gene Name: GDNFRB, NTNRA, RETL2, TRNR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022103: 96%, ENSRNOG00000014010: 97%
Entrez Gene ID: 2675
Uniprot ID: O00451
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCR
• Gene Sequence: SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCR
• Gene ID - Mouse: ENSMUSG00000022103
• Gene ID - Rat: ENSRNOG00000014010
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.