Anti GFRA2 pAb (ATL-HPA024704)
Atlas Antibodies
- SKU:
- ATL-HPA024704-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GFRA2
Alternative Gene Name: GDNFRB, NTNRA, RETL2, TRNR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022103: 96%, ENSRNOG00000014010: 97%
Entrez Gene ID: 2675
Uniprot ID: O00451
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCR |
Gene Sequence | SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCR |
Gene ID - Mouse | ENSMUSG00000022103 |
Gene ID - Rat | ENSRNOG00000014010 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GFRA2 pAb (ATL-HPA024704) | |
Datasheet | Anti GFRA2 pAb (ATL-HPA024704) Datasheet (External Link) |
Vendor Page | Anti GFRA2 pAb (ATL-HPA024704) at Atlas Antibodies |
Documents & Links for Anti GFRA2 pAb (ATL-HPA024704) | |
Datasheet | Anti GFRA2 pAb (ATL-HPA024704) Datasheet (External Link) |
Vendor Page | Anti GFRA2 pAb (ATL-HPA024704) |