Anti GFRA2 pAb (ATL-HPA024704)

Atlas Antibodies

Catalog No.:
ATL-HPA024704-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: GDNF family receptor alpha 2
Gene Name: GFRA2
Alternative Gene Name: GDNFRB, NTNRA, RETL2, TRNR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022103: 96%, ENSRNOG00000014010: 97%
Entrez Gene ID: 2675
Uniprot ID: O00451
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCR
Gene Sequence SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCR
Gene ID - Mouse ENSMUSG00000022103
Gene ID - Rat ENSRNOG00000014010
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GFRA2 pAb (ATL-HPA024704)
Datasheet Anti GFRA2 pAb (ATL-HPA024704) Datasheet (External Link)
Vendor Page Anti GFRA2 pAb (ATL-HPA024704) at Atlas Antibodies

Documents & Links for Anti GFRA2 pAb (ATL-HPA024704)
Datasheet Anti GFRA2 pAb (ATL-HPA024704) Datasheet (External Link)
Vendor Page Anti GFRA2 pAb (ATL-HPA024704)