Anti GFOD1 pAb (ATL-HPA029096)

Atlas Antibodies

Catalog No.:
ATL-HPA029096-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: glucose-fructose oxidoreductase domain containing 1
Gene Name: GFOD1
Alternative Gene Name: ADG-90, C6orf114, FLJ20330
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051335: 100%, ENSRNOG00000014007: 100%
Entrez Gene ID: 54438
Uniprot ID: Q9NXC2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FQDQDDRRTWDGRPLTMAATFDDCLYALCVVDTIKRSSQTGEWQNIAIMTEEPELSPAYLISEAMRRSRMSLYC
Gene Sequence FQDQDDRRTWDGRPLTMAATFDDCLYALCVVDTIKRSSQTGEWQNIAIMTEEPELSPAYLISEAMRRSRMSLYC
Gene ID - Mouse ENSMUSG00000051335
Gene ID - Rat ENSRNOG00000014007
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GFOD1 pAb (ATL-HPA029096)
Datasheet Anti GFOD1 pAb (ATL-HPA029096) Datasheet (External Link)
Vendor Page Anti GFOD1 pAb (ATL-HPA029096) at Atlas Antibodies

Documents & Links for Anti GFOD1 pAb (ATL-HPA029096)
Datasheet Anti GFOD1 pAb (ATL-HPA029096) Datasheet (External Link)
Vendor Page Anti GFOD1 pAb (ATL-HPA029096)