Anti GFOD1 pAb (ATL-HPA029096)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029096-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GFOD1
Alternative Gene Name: ADG-90, C6orf114, FLJ20330
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051335: 100%, ENSRNOG00000014007: 100%
Entrez Gene ID: 54438
Uniprot ID: Q9NXC2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FQDQDDRRTWDGRPLTMAATFDDCLYALCVVDTIKRSSQTGEWQNIAIMTEEPELSPAYLISEAMRRSRMSLYC |
| Gene Sequence | FQDQDDRRTWDGRPLTMAATFDDCLYALCVVDTIKRSSQTGEWQNIAIMTEEPELSPAYLISEAMRRSRMSLYC |
| Gene ID - Mouse | ENSMUSG00000051335 |
| Gene ID - Rat | ENSRNOG00000014007 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GFOD1 pAb (ATL-HPA029096) | |
| Datasheet | Anti GFOD1 pAb (ATL-HPA029096) Datasheet (External Link) |
| Vendor Page | Anti GFOD1 pAb (ATL-HPA029096) at Atlas Antibodies |
| Documents & Links for Anti GFOD1 pAb (ATL-HPA029096) | |
| Datasheet | Anti GFOD1 pAb (ATL-HPA029096) Datasheet (External Link) |
| Vendor Page | Anti GFOD1 pAb (ATL-HPA029096) |