Anti GFER pAb (ATL-HPA041227)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041227-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GFER
Alternative Gene Name: ALR, ERV1, HERV1, HPO1, HPO2, HSS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040888: 86%, ENSRNOG00000013370: 85%
Entrez Gene ID: 2671
Uniprot ID: P55789
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD |
| Gene Sequence | QQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD |
| Gene ID - Mouse | ENSMUSG00000040888 |
| Gene ID - Rat | ENSRNOG00000013370 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GFER pAb (ATL-HPA041227) | |
| Datasheet | Anti GFER pAb (ATL-HPA041227) Datasheet (External Link) |
| Vendor Page | Anti GFER pAb (ATL-HPA041227) at Atlas Antibodies |
| Documents & Links for Anti GFER pAb (ATL-HPA041227) | |
| Datasheet | Anti GFER pAb (ATL-HPA041227) Datasheet (External Link) |
| Vendor Page | Anti GFER pAb (ATL-HPA041227) |
| Citations for Anti GFER pAb (ATL-HPA041227) – 3 Found |
| Thomas, Luke W; Stephen, Jenna M; Esposito, Cinzia; Hoer, Simon; Antrobus, Robin; Ahmed, Afshan; Al-Habib, Hasan; Ashcroft, Margaret. CHCHD4 confers metabolic vulnerabilities to tumour cells through its control of the mitochondrial respiratory chain. Cancer & Metabolism. 7( 30886710):2. PubMed |
| Ferecatu, Ioana; Gonçalves, Sergio; Golinelli-Cohen, Marie-Pierre; Clémancey, Martin; Martelli, Alain; Riquier, Sylvie; Guittet, Eric; Latour, Jean-Marc; Puccio, Hélène; Drapier, Jean-Claude; Lescop, Ewen; Bouton, Cécile. The diabetes drug target MitoNEET governs a novel trafficking pathway to rebuild an Fe-S cluster into cytosolic aconitase/iron regulatory protein 1. The Journal Of Biological Chemistry. 2014;289(41):28070-86. PubMed |
| Lehmer, Carina; Schludi, Martin H; Ransom, Linnea; Greiling, Johanna; Junghänel, Michaela; Exner, Nicole; Riemenschneider, Henrick; van der Zee, Julie; Van Broeckhoven, Christine; Weydt, Patrick; Heneka, Michael T; Edbauer, Dieter. A novel CHCHD10 mutation implicates a Mia40-dependent mitochondrial import deficit in ALS. Embo Molecular Medicine. 2018;10(6) PubMed |