Anti GEMIN6 pAb (ATL-HPA035727)

Atlas Antibodies

Catalog No.:
ATL-HPA035727-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: gem (nuclear organelle) associated protein 6
Gene Name: GEMIN6
Alternative Gene Name: FLJ23459
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055760: 86%, ENSRNOG00000027332: 84%
Entrez Gene ID: 79833
Uniprot ID: Q8WXD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSEWMKKGPLEWQDYIYKEVRVTASEKNEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGIMGHAVQTVET
Gene Sequence MSEWMKKGPLEWQDYIYKEVRVTASEKNEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGIMGHAVQTVET
Gene ID - Mouse ENSMUSG00000055760
Gene ID - Rat ENSRNOG00000027332
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GEMIN6 pAb (ATL-HPA035727)
Datasheet Anti GEMIN6 pAb (ATL-HPA035727) Datasheet (External Link)
Vendor Page Anti GEMIN6 pAb (ATL-HPA035727) at Atlas Antibodies

Documents & Links for Anti GEMIN6 pAb (ATL-HPA035727)
Datasheet Anti GEMIN6 pAb (ATL-HPA035727) Datasheet (External Link)
Vendor Page Anti GEMIN6 pAb (ATL-HPA035727)