Anti GEMIN6 pAb (ATL-HPA035727)
Atlas Antibodies
- SKU:
- ATL-HPA035727-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GEMIN6
Alternative Gene Name: FLJ23459
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055760: 86%, ENSRNOG00000027332: 84%
Entrez Gene ID: 79833
Uniprot ID: Q8WXD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MSEWMKKGPLEWQDYIYKEVRVTASEKNEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGIMGHAVQTVET |
Gene Sequence | MSEWMKKGPLEWQDYIYKEVRVTASEKNEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGIMGHAVQTVET |
Gene ID - Mouse | ENSMUSG00000055760 |
Gene ID - Rat | ENSRNOG00000027332 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GEMIN6 pAb (ATL-HPA035727) | |
Datasheet | Anti GEMIN6 pAb (ATL-HPA035727) Datasheet (External Link) |
Vendor Page | Anti GEMIN6 pAb (ATL-HPA035727) at Atlas Antibodies |
Documents & Links for Anti GEMIN6 pAb (ATL-HPA035727) | |
Datasheet | Anti GEMIN6 pAb (ATL-HPA035727) Datasheet (External Link) |
Vendor Page | Anti GEMIN6 pAb (ATL-HPA035727) |