Anti GEMIN5 pAb (ATL-HPA037393)

Atlas Antibodies

SKU: ATL-HPA037393-25

• 
• 
• 

Protein Description: gem (nuclear organelle) associated protein 5
Gene Name: GEMIN5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037275: 60%, ENSRNOG00000002645: 59%
Entrez Gene ID: 25929
Uniprot ID: Q8TEQ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YDSGSFTIMQEVYSAFLPDGCDHLRDKLGDHQSPATPAFKSLEAFFLYGRLYEFWWSLSRPCPNSSVWVRAGHRTLSVEPSQQLDTASTEETDPET
• Gene Sequence: YDSGSFTIMQEVYSAFLPDGCDHLRDKLGDHQSPATPAFKSLEAFFLYGRLYEFWWSLSRPCPNSSVWVRAGHRTLSVEPSQQLDTASTEETDPET
• Gene ID - Mouse: ENSMUSG00000037275
• Gene ID - Rat: ENSRNOG00000002645
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GEMIN5 pAb (ATL-HPA037393) – 2 Found

Sapaly, Delphine; Delers, Perrine; Coridon, Jennifer; Salman, Badih; Letourneur, Franck; Dumont, Florent; Lefebvre, Suzie. The Small-Molecule Flunarizine in Spinal Muscular Atrophy Patient Fibroblasts Impacts on the Gemin Components of the SMN Complex and TDP43, an RNA-Binding Protein Relevant to Motor Neuron Diseases. Frontiers In Molecular Biosciences. 7( 32363199):55. 

Kour, Sukhleen; Rajan, Deepa S; Fortuna, Tyler R; Anderson, Eric N; Ward, Caroline; Lee, Youngha; Lee, Sangmoon; Shin, Yong Beom; Chae, Jong-Hee; Choi, Murim; Siquier, Karine; Cantagrel, Vincent; Amiel, Jeanne; Stolerman, Elliot S; Barnett, Sarah S; Cousin, Margot A; Castro, Diana; McDonald, Kimberly; Kirmse, Brian; Nemeth, Andrea H; Rajasundaram, Dhivyaa; Innes, A Micheil; Lynch, Danielle; Frosk, Patrick; Collins, Abigail; Gibbons, Melissa; Yang, Michele; Desguerre, Isabelle; Boddaert, Nathalie; Gitiaux, Cyril; Rydning, Siri Lynne; Selmer, Kaja K; Urreizti, Roser; Garcia-Oguiza, Alberto; Osorio, Andrés Nascimento; Verdura, Edgard; Pujol, Aurora; McCurry, Hannah R; Landers, John E; Agnihotri, Sameer; Andriescu, E Corina; Moody, Shade B; Phornphutkul, Chanika; Sacoto, Maria J Guillen; Begtrup, Amber; Houlden, Henry; Kirschner, Janbernd; Schorling, David; Rudnik-Schöneborn, Sabine; Strom, Tim M; Leiz, Steffen; Juliette, Kali; Richardson, Randal; Yang, Ying; Zhang, Yuehua; Wang, Minghui; Wang, Jia; Wang, Xiaodong; Platzer, Konrad; Donkervoort, Sandra; Bönnemann, Carsten G; Wagner, Matias; Issa, Mahmoud Y; Elbendary, Hasnaa M; Stanley, Valentina; Maroofian, Reza; Gleeson, Joseph G; Zaki, Maha S; Senderek, Jan; Pandey, Udai Bhan. Loss of function mutations in GEMIN5 cause a neurodevelopmental disorder. Nature Communications. 2021;12(1):2558.