Anti GEMIN5 pAb (ATL-HPA037392)

Atlas Antibodies

Catalog No.:
ATL-HPA037392-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: gem (nuclear organelle) associated protein 5
Gene Name: GEMIN5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037275: 86%, ENSRNOG00000002645: 88%
Entrez Gene ID: 25929
Uniprot ID: Q8TEQ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HNPWKLSGEAFDINKLIRDTNSIKYKLPVHTEISWKADGKIMALGNEDGSIEIFQIPNLKLICTIQQHHKLVNTISWHHEHGSQPELSYLMA
Gene Sequence HNPWKLSGEAFDINKLIRDTNSIKYKLPVHTEISWKADGKIMALGNEDGSIEIFQIPNLKLICTIQQHHKLVNTISWHHEHGSQPELSYLMA
Gene ID - Mouse ENSMUSG00000037275
Gene ID - Rat ENSRNOG00000002645
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GEMIN5 pAb (ATL-HPA037392)
Datasheet Anti GEMIN5 pAb (ATL-HPA037392) Datasheet (External Link)
Vendor Page Anti GEMIN5 pAb (ATL-HPA037392) at Atlas Antibodies

Documents & Links for Anti GEMIN5 pAb (ATL-HPA037392)
Datasheet Anti GEMIN5 pAb (ATL-HPA037392) Datasheet (External Link)
Vendor Page Anti GEMIN5 pAb (ATL-HPA037392)