Anti GEM pAb (ATL-HPA024798 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA024798-25

Protein Description: GTP binding protein overexpressed in skeletal muscle
Gene Name: GEM
Alternative Gene Name: KIR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028214: 99%, ENSRNOG00000015160: 56%
Entrez Gene ID: 2669
Uniprot ID: P55040
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NTYYRVVLIGEQGVGKSTLANIFAGVHDSMDSDCEVLGEDTYERTLMVDGESATIILLDMWENKGENEWLHDHCMQVGDAYLIVYSITD
• Gene Sequence: NTYYRVVLIGEQGVGKSTLANIFAGVHDSMDSDCEVLGEDTYERTLMVDGESATIILLDMWENKGENEWLHDHCMQVGDAYLIVYSITD
• Gene ID - Mouse: ENSMUSG00000028214
• Gene ID - Rat: ENSRNOG00000015160
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.