Anti GEM pAb (ATL-HPA024798 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA024798-25
  • Immunohistochemical staining of human gallbladder shows strong cytoplasmic positivity in glandular cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and GEM over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY405649).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: GTP binding protein overexpressed in skeletal muscle
Gene Name: GEM
Alternative Gene Name: KIR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028214: 99%, ENSRNOG00000015160: 56%
Entrez Gene ID: 2669
Uniprot ID: P55040
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NTYYRVVLIGEQGVGKSTLANIFAGVHDSMDSDCEVLGEDTYERTLMVDGESATIILLDMWENKGENEWLHDHCMQVGDAYLIVYSITD
Gene Sequence NTYYRVVLIGEQGVGKSTLANIFAGVHDSMDSDCEVLGEDTYERTLMVDGESATIILLDMWENKGENEWLHDHCMQVGDAYLIVYSITD
Gene ID - Mouse ENSMUSG00000028214
Gene ID - Rat ENSRNOG00000015160
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GEM pAb (ATL-HPA024798 w/enhanced validation)
Datasheet Anti GEM pAb (ATL-HPA024798 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GEM pAb (ATL-HPA024798 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GEM pAb (ATL-HPA024798 w/enhanced validation)
Datasheet Anti GEM pAb (ATL-HPA024798 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GEM pAb (ATL-HPA024798 w/enhanced validation)