Anti GDF5 pAb (ATL-HPA015648)
Atlas Antibodies
- SKU:
- ATL-HPA015648-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GDF5
Alternative Gene Name: BMP14, CDMP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038259: 93%, ENSRNOG00000050123: 93%
Entrez Gene ID: 8200
Uniprot ID: P43026
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RYVFDISALEKDGLLGAELRILRKKPSDTAKPAAPGGGRAAQLKLSSCPSGRQPASLLDVRSVPGLDGSGWEVFDIWKLFRNFKNSAQLCLELEAWERGRAVDL |
Gene Sequence | RYVFDISALEKDGLLGAELRILRKKPSDTAKPAAPGGGRAAQLKLSSCPSGRQPASLLDVRSVPGLDGSGWEVFDIWKLFRNFKNSAQLCLELEAWERGRAVDL |
Gene ID - Mouse | ENSMUSG00000038259 |
Gene ID - Rat | ENSRNOG00000050123 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GDF5 pAb (ATL-HPA015648) | |
Datasheet | Anti GDF5 pAb (ATL-HPA015648) Datasheet (External Link) |
Vendor Page | Anti GDF5 pAb (ATL-HPA015648) at Atlas Antibodies |
Documents & Links for Anti GDF5 pAb (ATL-HPA015648) | |
Datasheet | Anti GDF5 pAb (ATL-HPA015648) Datasheet (External Link) |
Vendor Page | Anti GDF5 pAb (ATL-HPA015648) |