Anti GDF5 pAb (ATL-HPA015648)

Atlas Antibodies

SKU:
ATL-HPA015648-25
  • Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: growth differentiation factor 5
Gene Name: GDF5
Alternative Gene Name: BMP14, CDMP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038259: 93%, ENSRNOG00000050123: 93%
Entrez Gene ID: 8200
Uniprot ID: P43026
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen RYVFDISALEKDGLLGAELRILRKKPSDTAKPAAPGGGRAAQLKLSSCPSGRQPASLLDVRSVPGLDGSGWEVFDIWKLFRNFKNSAQLCLELEAWERGRAVDL
Gene Sequence RYVFDISALEKDGLLGAELRILRKKPSDTAKPAAPGGGRAAQLKLSSCPSGRQPASLLDVRSVPGLDGSGWEVFDIWKLFRNFKNSAQLCLELEAWERGRAVDL
Gene ID - Mouse ENSMUSG00000038259
Gene ID - Rat ENSRNOG00000050123
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GDF5 pAb (ATL-HPA015648)
Datasheet Anti GDF5 pAb (ATL-HPA015648) Datasheet (External Link)
Vendor Page Anti GDF5 pAb (ATL-HPA015648) at Atlas Antibodies

Documents & Links for Anti GDF5 pAb (ATL-HPA015648)
Datasheet Anti GDF5 pAb (ATL-HPA015648) Datasheet (External Link)
Vendor Page Anti GDF5 pAb (ATL-HPA015648)