Anti GDF15 pAb (ATL-HPA011191 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA011191-25

• 
• 
• 

Protein Description: growth differentiation factor 15
Gene Name: GDF15
Alternative Gene Name: MIC-1, MIC1, NAG-1, PDF, PLAB, PTGFB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038508: 53%, ENSRNOG00000019661: 51%
Entrez Gene ID: 9518
Uniprot ID: Q99988
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQL
• Gene Sequence: LSLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQL
• Gene ID - Mouse: ENSMUSG00000038508
• Gene ID - Rat: ENSRNOG00000019661
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GDF15 pAb (ATL-HPA011191 w/enhanced validation) – 13 Found

Uchiyama, Tatsuki; Kawabata, Hiroshi; Miura, Yasuo; Yoshioka, Satoshi; Iwasa, Masaki; Yao, Hisayuki; Sakamoto, Soichiro; Fujimoto, Masakazu; Haga, Hironori; Kadowaki, Norimitsu; Maekawa, Taira; Takaori-Kondo, Akifumi. The role of growth differentiation factor 15 in the pathogenesis of primary myelofibrosis. Cancer Medicine. 2015;4(10):1558-72. 

Souček, Karel; Malenovská, Alice; Kahounová, Zuzana; Remšík, Ján; Holubcová, Zuzana; Soukup, Tomáš; Kurfürstová, Daniela; Bouchal, Jan; Suchánková, Tereza; Slabáková, Eva; Hampl, Aleš. Presence of growth/differentiation factor-15 cytokine in human follicular fluid, granulosa cells, and oocytes. Journal Of Assisted Reproduction And Genetics. 2018;35(8):1407-1417. 

Buchholz, Karolina; Antosik, Paulina; Grzanka, Dariusz; Gagat, Maciej; Smolińska, Marta; Grzanka, Alina; Gzil, Arkadiusz; Kasperska, Anna; Klimaszewska-Wiśniewska, Anna. Expression of the Body-Weight Signaling Players: GDF15, GFRAL and RET and their clinical relevance in Gastric Cancer. Journal Of Cancer. 12(15):4698-4709. 

Tabrizi, Ali Dastranj; Kalloger, Steve E; Köbel, Martin; Cipollone, Jane; Roskelley, Calvin D; Mehl, Erika; Gilks, C Blake. Primary ovarian mucinous carcinoma of intestinal type: significance of pattern of invasion and immunohistochemical expression profile in a series of 31 cases. International Journal Of Gynecological Pathology : Official Journal Of The International Society Of Gynecological Pathologists. 2010;29(2):99-107. 

Roth, Patrick; Junker, Markus; Tritschler, Isabel; Mittelbronn, Michel; Dombrowski, Yvonne; Breit, Samuel N; Tabatabai, Ghazaleh; Wick, Wolfgang; Weller, Michael; Wischhusen, Jörg. GDF-15 contributes to proliferation and immune escape of malignant gliomas. Clinical Cancer Research : An Official Journal Of The American Association For Cancer Research. 2010;16(15):3851-9. 

Wallin, U; Glimelius, B; Jirström, K; Darmanis, S; Nong, R Y; Pontén, F; Johansson, C; Påhlman, L; Birgisson, H. Growth differentiation factor 15: a prognostic marker for recurrence in colorectal cancer. British Journal Of Cancer. 2011;104(10):1619-27. 

Nickel, Nils; Jonigk, Danny; Kempf, Tibor; Bockmeyer, Clemens L; Maegel, Lavinia; Rische, Johanna; Laenger, Florian; Lehmann, Ulrich; Sauer, Clemens; Greer, Mark; Welte, Tobias; Hoeper, Marius M; Golpon, Heiko A. GDF-15 is abundantly expressed in plexiform lesions in patients with pulmonary arterial hypertension and affects proliferation and apoptosis of pulmonary endothelial cells. Respiratory Research. 2011;12(1):62. 

Liu, Xiuying; Chi, Xiumei; Gong, Qiaoling; Gao, Lei; Niu, Yuqiang; Chi, Xiaojing; Cheng, Min; Si, Youhui; Wang, Maorong; Zhong, Jin; Niu, Junqi; Yang, Wei. Association of serum level of growth differentiation factor 15 with liver cirrhosis and hepatocellular carcinoma. Plos One. 10(5):e0127518. 

Lee, Jennifer; Fricke, Fabia; Warnken, Uwe; Schnölzer, Martina; Kopitz, Jürgen; Gebert, Johannes. Reconstitution of TGFBR2-Mediated Signaling Causes Upregulation of GDF-15 in HCT116 Colorectal Cancer Cells. Plos One. 10(6):e0131506. 

Ishige, Takayuki; Nishimura, Motoi; Satoh, Mamoru; Fujimoto, Mai; Fukuyo, Masaki; Semba, Toshihisa; Kado, Sayaka; Tsuchida, Sachio; Sawai, Setsu; Matsushita, Kazuyuki; Togawa, Akira; Matsubara, Hisahiro; Kaneda, Atsushi; Nomura, Fumio. Combined Secretomics and Transcriptomics Revealed Cancer-Derived GDF15 is Involved in Diffuse-Type Gastric Cancer Progression and Fibroblast Activation. Scientific Reports. 2016;6( 26892343):21681. 

Blanchette-Farra, Nicole; Kita, Daniel; Konstorum, Anna; Tesfay, Lia; Lemler, David; Hegde, Poornima; Claffey, Kevin P; Torti, Frank M; Torti, Suzy V. Contribution of three-dimensional architecture and tumor-associated fibroblasts to hepcidin regulation in breast cancer. Oncogene. 2018;37(29):4013-4032. 

Radwanska, Agata; Cottage, Christopher Travis; Piras, Antonio; Overed-Sayer, Catherine; Sihlbom, Carina; Budida, Ramachandramouli; Wrench, Catherine; Connor, Jane; Monkley, Susan; Hazon, Petra; Schluter, Holger; Thomas, Matthew J; Hogaboam, Cory M; Murray, Lynne A. Increased expression and accumulation of GDF15 in IPF extracellular matrix contribute to fibrosis. Jci Insight. 2022;7(16) 

Joo, Mina; Kim, Donghyun; Lee, Myung-Won; Lee, Hyo Jin; Kim, Jin-Man. GDF15 Promotes Cell Growth, Migration, and Invasion in Gastric Cancer by Inducing STAT3 Activation. International Journal Of Molecular Sciences. 2023;24(3)