Anti GDA pAb (ATL-HPA030387 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA030387-100
  • Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using HPA030387 antibody. Corresponding GDA RNA-seq data are presented for the same tissues.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and GDA over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY418083).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: guanine deaminase
Gene Name: GDA
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058624: 93%, ENSRNOG00000018282: 92%
Entrez Gene ID: 9615
Uniprot ID: Q9Y2T3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FRGTFVHSTWTCPMEVLRDHLLGVSDSGKIVFLEEASQQEKLAKEWCFKPCEIRELSHHEFFMPGLVDTHIHASQYSFAGSSIDLPLLEWLT
Gene Sequence FRGTFVHSTWTCPMEVLRDHLLGVSDSGKIVFLEEASQQEKLAKEWCFKPCEIRELSHHEFFMPGLVDTHIHASQYSFAGSSIDLPLLEWLT
Gene ID - Mouse ENSMUSG00000058624
Gene ID - Rat ENSRNOG00000018282
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GDA pAb (ATL-HPA030387 w/enhanced validation)
Datasheet Anti GDA pAb (ATL-HPA030387 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GDA pAb (ATL-HPA030387 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GDA pAb (ATL-HPA030387 w/enhanced validation)
Datasheet Anti GDA pAb (ATL-HPA030387 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GDA pAb (ATL-HPA030387 w/enhanced validation)