Anti GDA pAb (ATL-HPA024099 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA024099-25
  • Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using HPA024099 antibody. Corresponding GDA RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleus.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: guanine deaminase
Gene Name: GDA
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058624: 95%, ENSRNOG00000018282: 94%
Entrez Gene ID: 9615
Uniprot ID: Q9Y2T3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NKVNEKSLTLKEVFRLATLGGSQALGLDGEIGNFEVGKEFDAILINPKASDSPIDLFYGDFFGDISEAVIQKFLYLGDDRNIEEVYVGGKQVVPF
Gene Sequence NKVNEKSLTLKEVFRLATLGGSQALGLDGEIGNFEVGKEFDAILINPKASDSPIDLFYGDFFGDISEAVIQKFLYLGDDRNIEEVYVGGKQVVPF
Gene ID - Mouse ENSMUSG00000058624
Gene ID - Rat ENSRNOG00000018282
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GDA pAb (ATL-HPA024099 w/enhanced validation)
Datasheet Anti GDA pAb (ATL-HPA024099 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GDA pAb (ATL-HPA024099 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GDA pAb (ATL-HPA024099 w/enhanced validation)
Datasheet Anti GDA pAb (ATL-HPA024099 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GDA pAb (ATL-HPA024099 w/enhanced validation)