Anti GCSAM pAb (ATL-HPA002473)

Atlas Antibodies

Catalog No.:
ATL-HPA002473-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: germinal center-associated, signaling and motility
Gene Name: GCSAM
Alternative Gene Name: GCET2, HGAL, MGC40441
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022659: 56%, ENSRNOG00000022110: 56%
Entrez Gene ID: 257144
Uniprot ID: Q8N6F7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HIAEGCFCLPWKKILIFEKRQDSQNENERMSSTPIQDNVDQTYSEELCYTLINHRVLCTRPSGNSAEEYYENVPCKAERPRESLGGTETEYSLLHMPSTDPRHARSPEDEYELLMPHRISSHFL
Gene Sequence HIAEGCFCLPWKKILIFEKRQDSQNENERMSSTPIQDNVDQTYSEELCYTLINHRVLCTRPSGNSAEEYYENVPCKAERPRESLGGTETEYSLLHMPSTDPRHARSPEDEYELLMPHRISSHFL
Gene ID - Mouse ENSMUSG00000022659
Gene ID - Rat ENSRNOG00000022110
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GCSAM pAb (ATL-HPA002473)
Datasheet Anti GCSAM pAb (ATL-HPA002473) Datasheet (External Link)
Vendor Page Anti GCSAM pAb (ATL-HPA002473) at Atlas Antibodies

Documents & Links for Anti GCSAM pAb (ATL-HPA002473)
Datasheet Anti GCSAM pAb (ATL-HPA002473) Datasheet (External Link)
Vendor Page Anti GCSAM pAb (ATL-HPA002473)