Anti GCNT4 pAb (ATL-HPA037431)

Atlas Antibodies

Catalog No.: ATL-HPA037431-25

Protein Description: glucosaminyl (N-acetyl) transferase 4, core 2
Gene Name: GCNT4
Alternative Gene Name: C2GNT3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091387: 85%, ENSRNOG00000055451: 90%
Entrez Gene ID: 51301
Uniprot ID: Q9P109
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VKWNYYEGFFYPSCTGSHLRSVCIYGAAELRWLIKDGHWFANKFDSKVDPILIKCLAEKLEEQQRDWITLPS
• Gene Sequence: VKWNYYEGFFYPSCTGSHLRSVCIYGAAELRWLIKDGHWFANKFDSKVDPILIKCLAEKLEEQQRDWITLPS
• Gene ID - Mouse: ENSMUSG00000091387
• Gene ID - Rat: ENSRNOG00000055451
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.