Anti GCNT4 pAb (ATL-HPA037431)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037431-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GCNT4
Alternative Gene Name: C2GNT3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091387: 85%, ENSRNOG00000055451: 90%
Entrez Gene ID: 51301
Uniprot ID: Q9P109
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VKWNYYEGFFYPSCTGSHLRSVCIYGAAELRWLIKDGHWFANKFDSKVDPILIKCLAEKLEEQQRDWITLPS |
Gene Sequence | VKWNYYEGFFYPSCTGSHLRSVCIYGAAELRWLIKDGHWFANKFDSKVDPILIKCLAEKLEEQQRDWITLPS |
Gene ID - Mouse | ENSMUSG00000091387 |
Gene ID - Rat | ENSRNOG00000055451 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GCNT4 pAb (ATL-HPA037431) | |
Datasheet | Anti GCNT4 pAb (ATL-HPA037431) Datasheet (External Link) |
Vendor Page | Anti GCNT4 pAb (ATL-HPA037431) at Atlas Antibodies |
Documents & Links for Anti GCNT4 pAb (ATL-HPA037431) | |
Datasheet | Anti GCNT4 pAb (ATL-HPA037431) Datasheet (External Link) |
Vendor Page | Anti GCNT4 pAb (ATL-HPA037431) |