Anti GCNT1 pAb (ATL-HPA031151)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031151-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GCNT1
Alternative Gene Name: C2GNT, NACGT2, NAGCT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038843: 86%, ENSRNOG00000050534: 83%
Entrez Gene ID: 2650
Uniprot ID: Q02742
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LINLCGMDFPIKTNLEIVRKLKLLMGENNLETERMPSHKEERWKKRYEVVNGKLTNTGTVKMLPPLETPLFSGSAYFVVSREYVGYVLQNEKIQKLMEWAQDTYSPDEYLWA |
| Gene Sequence | LINLCGMDFPIKTNLEIVRKLKLLMGENNLETERMPSHKEERWKKRYEVVNGKLTNTGTVKMLPPLETPLFSGSAYFVVSREYVGYVLQNEKIQKLMEWAQDTYSPDEYLWA |
| Gene ID - Mouse | ENSMUSG00000038843 |
| Gene ID - Rat | ENSRNOG00000050534 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GCNT1 pAb (ATL-HPA031151) | |
| Datasheet | Anti GCNT1 pAb (ATL-HPA031151) Datasheet (External Link) |
| Vendor Page | Anti GCNT1 pAb (ATL-HPA031151) at Atlas Antibodies |
| Documents & Links for Anti GCNT1 pAb (ATL-HPA031151) | |
| Datasheet | Anti GCNT1 pAb (ATL-HPA031151) Datasheet (External Link) |
| Vendor Page | Anti GCNT1 pAb (ATL-HPA031151) |