Anti GCNT1 pAb (ATL-HPA031151)

Atlas Antibodies

Catalog No.: ATL-HPA031151-25

Protein Description: glucosaminyl (N-acetyl) transferase 1, core 2
Gene Name: GCNT1
Alternative Gene Name: C2GNT, NACGT2, NAGCT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038843: 86%, ENSRNOG00000050534: 83%
Entrez Gene ID: 2650
Uniprot ID: Q02742
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LINLCGMDFPIKTNLEIVRKLKLLMGENNLETERMPSHKEERWKKRYEVVNGKLTNTGTVKMLPPLETPLFSGSAYFVVSREYVGYVLQNEKIQKLMEWAQDTYSPDEYLWA
• Gene Sequence: LINLCGMDFPIKTNLEIVRKLKLLMGENNLETERMPSHKEERWKKRYEVVNGKLTNTGTVKMLPPLETPLFSGSAYFVVSREYVGYVLQNEKIQKLMEWAQDTYSPDEYLWA
• Gene ID - Mouse: ENSMUSG00000038843
• Gene ID - Rat: ENSRNOG00000050534
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.