Anti GCNT1 pAb (ATL-HPA031151)

Atlas Antibodies

Catalog No.:
ATL-HPA031151-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: glucosaminyl (N-acetyl) transferase 1, core 2
Gene Name: GCNT1
Alternative Gene Name: C2GNT, NACGT2, NAGCT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038843: 86%, ENSRNOG00000050534: 83%
Entrez Gene ID: 2650
Uniprot ID: Q02742
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LINLCGMDFPIKTNLEIVRKLKLLMGENNLETERMPSHKEERWKKRYEVVNGKLTNTGTVKMLPPLETPLFSGSAYFVVSREYVGYVLQNEKIQKLMEWAQDTYSPDEYLWA
Gene Sequence LINLCGMDFPIKTNLEIVRKLKLLMGENNLETERMPSHKEERWKKRYEVVNGKLTNTGTVKMLPPLETPLFSGSAYFVVSREYVGYVLQNEKIQKLMEWAQDTYSPDEYLWA
Gene ID - Mouse ENSMUSG00000038843
Gene ID - Rat ENSRNOG00000050534
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GCNT1 pAb (ATL-HPA031151)
Datasheet Anti GCNT1 pAb (ATL-HPA031151) Datasheet (External Link)
Vendor Page Anti GCNT1 pAb (ATL-HPA031151) at Atlas Antibodies

Documents & Links for Anti GCNT1 pAb (ATL-HPA031151)
Datasheet Anti GCNT1 pAb (ATL-HPA031151) Datasheet (External Link)
Vendor Page Anti GCNT1 pAb (ATL-HPA031151)