Anti GCLM pAb (ATL-HPA023696 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023696-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GCLM
Alternative Gene Name: GLCLR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028124: 94%, ENSRNOG00000013409: 94%
Entrez Gene ID: 2730
Uniprot ID: P48507
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RTLHLQTGNLLNWGRLRKKCPSTHSEELHDCIQKTLNEWSSQINPDLVREFPDVLECTVSHAVE |
Gene Sequence | RTLHLQTGNLLNWGRLRKKCPSTHSEELHDCIQKTLNEWSSQINPDLVREFPDVLECTVSHAVE |
Gene ID - Mouse | ENSMUSG00000028124 |
Gene ID - Rat | ENSRNOG00000013409 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GCLM pAb (ATL-HPA023696 w/enhanced validation) | |
Datasheet | Anti GCLM pAb (ATL-HPA023696 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GCLM pAb (ATL-HPA023696 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti GCLM pAb (ATL-HPA023696 w/enhanced validation) | |
Datasheet | Anti GCLM pAb (ATL-HPA023696 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GCLM pAb (ATL-HPA023696 w/enhanced validation) |
Citations for Anti GCLM pAb (ATL-HPA023696 w/enhanced validation) – 2 Found |
Dequanter, Didier; VAN DE Velde, Maureen; Bar, Isabelle; Nuyens, Vincent; Rousseau, Alexandre; Nagy, Nathalie; Vanhamme, Luc; Vanhaeverbeek, Michel; Brohée, Dany; Delrée, Paul; Boudjeltia, Karim; Lothaire, Philippe; Uzureau, Pierrick. Nuclear localization of glutamate-cysteine ligase is associated with proliferation in head and neck squamous cell carcinoma. Oncology Letters. 2016;11(6):3660-3668. PubMed |
Umansky, Carla; Morellato, Agustín E; Rieckher, Matthias; Scheidegger, Marco A; Martinefski, Manuela R; Fernández, Gabriela A; Pak, Oleg; Kolesnikova, Ksenia; Reingruber, Hernán; Bollini, Mariela; Crossan, Gerry P; Sommer, Natascha; Monge, María Eugenia; Schumacher, Björn; Pontel, Lucas B. Endogenous formaldehyde scavenges cellular glutathione resulting in redox disruption and cytotoxicity. Nature Communications. 2022;13(1):745. PubMed |