Anti GCLM pAb (ATL-HPA023696 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA023696-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: glutamate-cysteine ligase, modifier subunit
Gene Name: GCLM
Alternative Gene Name: GLCLR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028124: 94%, ENSRNOG00000013409: 94%
Entrez Gene ID: 2730
Uniprot ID: P48507
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RTLHLQTGNLLNWGRLRKKCPSTHSEELHDCIQKTLNEWSSQINPDLVREFPDVLECTVSHAVE
Gene Sequence RTLHLQTGNLLNWGRLRKKCPSTHSEELHDCIQKTLNEWSSQINPDLVREFPDVLECTVSHAVE
Gene ID - Mouse ENSMUSG00000028124
Gene ID - Rat ENSRNOG00000013409
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GCLM pAb (ATL-HPA023696 w/enhanced validation)
Datasheet Anti GCLM pAb (ATL-HPA023696 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GCLM pAb (ATL-HPA023696 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GCLM pAb (ATL-HPA023696 w/enhanced validation)
Datasheet Anti GCLM pAb (ATL-HPA023696 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GCLM pAb (ATL-HPA023696 w/enhanced validation)
Citations for Anti GCLM pAb (ATL-HPA023696 w/enhanced validation) – 2 Found
Dequanter, Didier; VAN DE Velde, Maureen; Bar, Isabelle; Nuyens, Vincent; Rousseau, Alexandre; Nagy, Nathalie; Vanhamme, Luc; Vanhaeverbeek, Michel; Brohée, Dany; Delrée, Paul; Boudjeltia, Karim; Lothaire, Philippe; Uzureau, Pierrick. Nuclear localization of glutamate-cysteine ligase is associated with proliferation in head and neck squamous cell carcinoma. Oncology Letters. 2016;11(6):3660-3668.  PubMed
Umansky, Carla; Morellato, Agustín E; Rieckher, Matthias; Scheidegger, Marco A; Martinefski, Manuela R; Fernández, Gabriela A; Pak, Oleg; Kolesnikova, Ksenia; Reingruber, Hernán; Bollini, Mariela; Crossan, Gerry P; Sommer, Natascha; Monge, María Eugenia; Schumacher, Björn; Pontel, Lucas B. Endogenous formaldehyde scavenges cellular glutathione resulting in redox disruption and cytotoxicity. Nature Communications. 2022;13(1):745.  PubMed