Anti GCLC pAb (ATL-HPA036360 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA036360-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: glutamate-cysteine ligase, catalytic subunit
Gene Name: GCLC
Alternative Gene Name: GCS, GLCL, GLCLC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032350: 96%, ENSRNOG00000006302: 94%
Entrez Gene ID: 2729
Uniprot ID: P48506
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FENSAYVVFVVLLTRVILSYKLDFLIPLSKVDENMKVAQKRDAVLQGMFYFRKDICKGGNAVVDGCGKAQNSTELAAEEYTLMSIDTIINGKEGVFPGLIP
Gene Sequence FENSAYVVFVVLLTRVILSYKLDFLIPLSKVDENMKVAQKRDAVLQGMFYFRKDICKGGNAVVDGCGKAQNSTELAAEEYTLMSIDTIINGKEGVFPGLIP
Gene ID - Mouse ENSMUSG00000032350
Gene ID - Rat ENSRNOG00000006302
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GCLC pAb (ATL-HPA036360 w/enhanced validation)
Datasheet Anti GCLC pAb (ATL-HPA036360 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GCLC pAb (ATL-HPA036360 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GCLC pAb (ATL-HPA036360 w/enhanced validation)
Datasheet Anti GCLC pAb (ATL-HPA036360 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GCLC pAb (ATL-HPA036360 w/enhanced validation)
Citations for Anti GCLC pAb (ATL-HPA036360 w/enhanced validation) – 1 Found
Prokai, David; Pudasaini, Ashutosh; Kanchwala, Mohammed; Moehlman, Andrew T; Waits, Alexandrea E; Chapman, Karen M; Chaudhary, Jaideep; Acevedo, Jesus; Keller, Patrick; Chao, Xing; Carr, Bruce R; Hamra, F Kent. Spermatogonial Gene Networks Selectively Couple to Glutathione and Pentose Phosphate Metabolism but Not Cysteine Biosynthesis. Iscience. 2021;24(1):101880.  PubMed