Anti GCLC pAb (ATL-HPA036360 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA036360-25

Protein Description: glutamate-cysteine ligase, catalytic subunit
Gene Name: GCLC
Alternative Gene Name: GCS, GLCL, GLCLC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032350: 96%, ENSRNOG00000006302: 94%
Entrez Gene ID: 2729
Uniprot ID: P48506
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FENSAYVVFVVLLTRVILSYKLDFLIPLSKVDENMKVAQKRDAVLQGMFYFRKDICKGGNAVVDGCGKAQNSTELAAEEYTLMSIDTIINGKEGVFPGLIP
• Gene Sequence: FENSAYVVFVVLLTRVILSYKLDFLIPLSKVDENMKVAQKRDAVLQGMFYFRKDICKGGNAVVDGCGKAQNSTELAAEEYTLMSIDTIINGKEGVFPGLIP
• Gene ID - Mouse: ENSMUSG00000032350
• Gene ID - Rat: ENSRNOG00000006302
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GCLC pAb (ATL-HPA036360 w/enhanced validation) – 1 Found

Prokai, David; Pudasaini, Ashutosh; Kanchwala, Mohammed; Moehlman, Andrew T; Waits, Alexandrea E; Chapman, Karen M; Chaudhary, Jaideep; Acevedo, Jesus; Keller, Patrick; Chao, Xing; Carr, Bruce R; Hamra, F Kent. Spermatogonial Gene Networks Selectively Couple to Glutathione and Pentose Phosphate Metabolism but Not Cysteine Biosynthesis. Iscience. 2021;24(1):101880.