Anti GCH1 pAb (ATL-HPA028612)

Atlas Antibodies

Catalog No.: ATL-HPA028612-25

Protein Description: GTP cyclohydrolase 1
Gene Name: GCH1
Alternative Gene Name: DYT14, DYT5, DYT5a, GCH, GTPCH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037580: 93%, ENSRNOG00000011039: 97%
Entrez Gene ID: 2643
Uniprot ID: P30793
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQE
• Gene Sequence: ELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQE
• Gene ID - Mouse: ENSMUSG00000037580
• Gene ID - Rat: ENSRNOG00000011039
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GCH1 pAb (ATL-HPA028612) – 2 Found

Petty, Alice; Cui, Xiaoying; Tesiram, Yasvir; Kirik, Deniz; Howes, Oliver; Eyles, Darryl. Enhanced Dopamine in Prodromal Schizophrenia (EDiPS): a new animal model of relevance to schizophrenia. Npj Schizophrenia. 2019;5(1):6. 

Li, Qiang; Youn, Ji Youn; Siu, Kin Lung; Murugesan, Priya; Zhang, Yixuan; Cai, Hua. Knockout of dihydrofolate reductase in mice induces hypertension and abdominal aortic aneurysm via mitochondrial dysfunction. Redox Biology. 2019;24( 30954686):101185.