Anti GCH1 pAb (ATL-HPA028612)
Atlas Antibodies
- SKU:
- ATL-HPA028612-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GCH1
Alternative Gene Name: DYT14, DYT5, DYT5a, GCH, GTPCH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037580: 93%, ENSRNOG00000011039: 97%
Entrez Gene ID: 2643
Uniprot ID: P30793
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQE |
| Gene Sequence | ELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQE |
| Gene ID - Mouse | ENSMUSG00000037580 |
| Gene ID - Rat | ENSRNOG00000011039 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GCH1 pAb (ATL-HPA028612) | |
| Datasheet | Anti GCH1 pAb (ATL-HPA028612) Datasheet (External Link) |
| Vendor Page | Anti GCH1 pAb (ATL-HPA028612) at Atlas Antibodies |
| Documents & Links for Anti GCH1 pAb (ATL-HPA028612) | |
| Datasheet | Anti GCH1 pAb (ATL-HPA028612) Datasheet (External Link) |
| Vendor Page | Anti GCH1 pAb (ATL-HPA028612) |
| Citations for Anti GCH1 pAb (ATL-HPA028612) – 2 Found |
| Petty, Alice; Cui, Xiaoying; Tesiram, Yasvir; Kirik, Deniz; Howes, Oliver; Eyles, Darryl. Enhanced Dopamine in Prodromal Schizophrenia (EDiPS): a new animal model of relevance to schizophrenia. Npj Schizophrenia. 2019;5(1):6. PubMed |
| Li, Qiang; Youn, Ji Youn; Siu, Kin Lung; Murugesan, Priya; Zhang, Yixuan; Cai, Hua. Knockout of dihydrofolate reductase in mice induces hypertension and abdominal aortic aneurysm via mitochondrial dysfunction. Redox Biology. 2019;24( 30954686):101185. PubMed |