Anti GCG pAb (ATL-HPA036760 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036760-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: GCG
Alternative Gene Name: GLP1, GLP2, GRPP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000394: 85%, ENSRNOG00000005498: 85%
Entrez Gene ID: 2641
Uniprot ID: P01275
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEF |
Gene Sequence | RSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEF |
Gene ID - Mouse | ENSMUSG00000000394 |
Gene ID - Rat | ENSRNOG00000005498 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GCG pAb (ATL-HPA036760 w/enhanced validation) | |
Datasheet | Anti GCG pAb (ATL-HPA036760 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GCG pAb (ATL-HPA036760 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti GCG pAb (ATL-HPA036760 w/enhanced validation) | |
Datasheet | Anti GCG pAb (ATL-HPA036760 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GCG pAb (ATL-HPA036760 w/enhanced validation) |