Anti GCG pAb (ATL-HPA036760 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA036760-25

• 
• 

Protein Description: glucagon
Gene Name: GCG
Alternative Gene Name: GLP1, GLP2, GRPP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000394: 85%, ENSRNOG00000005498: 85%
Entrez Gene ID: 2641
Uniprot ID: P01275
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEF
• Gene Sequence: RSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEF
• Gene ID - Mouse: ENSMUSG00000000394
• Gene ID - Rat: ENSRNOG00000005498
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.