Anti GCDH pAb (ATL-HPA043252 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA043252-25

• 
• 
• 

Protein Description: glutaryl-CoA dehydrogenase
Gene Name: GCDH
Alternative Gene Name: ACAD5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003809: 87%, ENSRNOG00000003307: 88%
Entrez Gene ID: 2639
Uniprot ID: Q92947
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SRPEFDWQDPLVLEEQLTTDEILIRDTFRTYCQERLMPRILLANRNEVFHREIISEMGELGVLGPTIKGYGCAGV
• Gene Sequence: SRPEFDWQDPLVLEEQLTTDEILIRDTFRTYCQERLMPRILLANRNEVFHREIISEMGELGVLGPTIKGYGCAGV
• Gene ID - Mouse: ENSMUSG00000003809
• Gene ID - Rat: ENSRNOG00000003307
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.