Anti GCC2 pAb (ATL-HPA035850)

Atlas Antibodies

Catalog No.:
ATL-HPA035850-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: GRIP and coiled-coil domain containing 2
Gene Name: GCC2
Alternative Gene Name: GCC185, KIAA0336
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000107275: 67%, ENSRNOG00000000823: 61%
Entrez Gene ID: 9648
Uniprot ID: Q8IWJ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLLSQQELVPELENTIKNLQEKNGVYLLSLSQRDTMLKELEGKINSLTEEKDDFINKLKNSHEEMDNFHKKCEREERLILELGKKVEQTIQYNS
Gene Sequence KLLSQQELVPELENTIKNLQEKNGVYLLSLSQRDTMLKELEGKINSLTEEKDDFINKLKNSHEEMDNFHKKCEREERLILELGKKVEQTIQYNS
Gene ID - Mouse ENSMUSG00000107275
Gene ID - Rat ENSRNOG00000000823
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GCC2 pAb (ATL-HPA035850)
Datasheet Anti GCC2 pAb (ATL-HPA035850) Datasheet (External Link)
Vendor Page Anti GCC2 pAb (ATL-HPA035850) at Atlas Antibodies

Documents & Links for Anti GCC2 pAb (ATL-HPA035850)
Datasheet Anti GCC2 pAb (ATL-HPA035850) Datasheet (External Link)
Vendor Page Anti GCC2 pAb (ATL-HPA035850)