Anti GCC1 pAb (ATL-HPA021323 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA021323-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GCC1
Alternative Gene Name: FLJ22035, GCC1P, GCC88, MGC20706
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029708: 95%, ENSRNOG00000007792: 94%
Entrez Gene ID: 79571
Uniprot ID: Q96CN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GDPADTSSSDSLTQALQLAAANEPTFFLYAEQLARKEVEITSLRKQKHRLEVEVHQLQDRLLEEGERHREEVAALQSHIEKNIRDQSREGANLEYLKNIIYRFLTLPDSLGRQQTLTAILTILHFSPEEKQVIMRLPT |
Gene Sequence | GDPADTSSSDSLTQALQLAAANEPTFFLYAEQLARKEVEITSLRKQKHRLEVEVHQLQDRLLEEGERHREEVAALQSHIEKNIRDQSREGANLEYLKNIIYRFLTLPDSLGRQQTLTAILTILHFSPEEKQVIMRLPT |
Gene ID - Mouse | ENSMUSG00000029708 |
Gene ID - Rat | ENSRNOG00000007792 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GCC1 pAb (ATL-HPA021323 w/enhanced validation) | |
Datasheet | Anti GCC1 pAb (ATL-HPA021323 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GCC1 pAb (ATL-HPA021323 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti GCC1 pAb (ATL-HPA021323 w/enhanced validation) | |
Datasheet | Anti GCC1 pAb (ATL-HPA021323 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GCC1 pAb (ATL-HPA021323 w/enhanced validation) |
Citations for Anti GCC1 pAb (ATL-HPA021323 w/enhanced validation) – 4 Found |
Wong, Mie; Gillingham, Alison K; Munro, Sean. The golgin coiled-coil proteins capture different types of transport carriers via distinct N-terminal motifs. Bmc Biology. 2017;15(1):3. PubMed |
Kobayashi, Kyousuke; Suemasa, Fumiko; Sagara, Hiroshi; Nakamura, Shinya; Ino, Yasushi; Kobayashi, Kazuyoshi; Hiramatsu, Hiroaki; Haraguchi, Takeshi; Kurokawa, Kazuo; Todo, Tomoki; Nakano, Akihiko; Iba, Hideo. MiR-199a Inhibits Secondary Envelopment of Herpes Simplex Virus-1 Through the Downregulation of Cdc42-specific GTPase Activating Protein Localized in Golgi Apparatus. Scientific Reports. 2017;7(1):6650. PubMed |
Wong, Mie; Munro, Sean. Membrane trafficking. The specificity of vesicle traffic to the Golgi is encoded in the golgin coiled-coil proteins. Science (New York, N.y.). 2014;346(6209):1256898. PubMed |
Ishida, Morié; Bonifacino, Juan S. ARFRP1 functions upstream of ARL1 and ARL5 to coordinate recruitment of distinct tethering factors to the trans-Golgi network. The Journal Of Cell Biology. 2019;218(11):3681-3696. PubMed |