Anti GCC1 pAb (ATL-HPA021323 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA021323-25

• 
• 
• 

Protein Description: GRIP and coiled-coil domain containing 1
Gene Name: GCC1
Alternative Gene Name: FLJ22035, GCC1P, GCC88, MGC20706
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029708: 95%, ENSRNOG00000007792: 94%
Entrez Gene ID: 79571
Uniprot ID: Q96CN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GDPADTSSSDSLTQALQLAAANEPTFFLYAEQLARKEVEITSLRKQKHRLEVEVHQLQDRLLEEGERHREEVAALQSHIEKNIRDQSREGANLEYLKNIIYRFLTLPDSLGRQQTLTAILTILHFSPEEKQVIMRLPT
• Gene Sequence: GDPADTSSSDSLTQALQLAAANEPTFFLYAEQLARKEVEITSLRKQKHRLEVEVHQLQDRLLEEGERHREEVAALQSHIEKNIRDQSREGANLEYLKNIIYRFLTLPDSLGRQQTLTAILTILHFSPEEKQVIMRLPT
• Gene ID - Mouse: ENSMUSG00000029708
• Gene ID - Rat: ENSRNOG00000007792
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GCC1 pAb (ATL-HPA021323 w/enhanced validation) – 4 Found

Wong, Mie; Gillingham, Alison K; Munro, Sean. The golgin coiled-coil proteins capture different types of transport carriers via distinct N-terminal motifs. Bmc Biology. 2017;15(1):3. 

Kobayashi, Kyousuke; Suemasa, Fumiko; Sagara, Hiroshi; Nakamura, Shinya; Ino, Yasushi; Kobayashi, Kazuyoshi; Hiramatsu, Hiroaki; Haraguchi, Takeshi; Kurokawa, Kazuo; Todo, Tomoki; Nakano, Akihiko; Iba, Hideo. MiR-199a Inhibits Secondary Envelopment of Herpes Simplex Virus-1 Through the Downregulation of Cdc42-specific GTPase Activating Protein Localized in Golgi Apparatus. Scientific Reports. 2017;7(1):6650. 

Wong, Mie; Munro, Sean. Membrane trafficking. The specificity of vesicle traffic to the Golgi is encoded in the golgin coiled-coil proteins. Science (New York, N.y.). 2014;346(6209):1256898. 

Ishida, Morié; Bonifacino, Juan S. ARFRP1 functions upstream of ARL1 and ARL5 to coordinate recruitment of distinct tethering factors to the trans-Golgi network. The Journal Of Cell Biology. 2019;218(11):3681-3696.