Anti GCC1 pAb (ATL-HPA019369 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA019369-25

• 
• 
• 

Protein Description: GRIP and coiled-coil domain containing 1
Gene Name: GCC1
Alternative Gene Name: FLJ22035, GCC1P, GCC88, MGC20706
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029708: 93%, ENSRNOG00000007792: 93%
Entrez Gene ID: 79571
Uniprot ID: Q96CN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LELRLEETREALAGRAYAAEQMEGFELQTKQLTREVEELKSELQAIRDEKNQPDPRLQELQEEAARLKSHFQAQLQQEMR
• Gene Sequence: LELRLEETREALAGRAYAAEQMEGFELQTKQLTREVEELKSELQAIRDEKNQPDPRLQELQEEAARLKSHFQAQLQQEMR
• Gene ID - Mouse: ENSMUSG00000029708
• Gene ID - Rat: ENSRNOG00000007792
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GCC1 pAb (ATL-HPA019369 w/enhanced validation) – 1 Found

Ziltener, Pascal; Rebane, Aleksander A; Graham, Morven; Ernst, Andreas M; Rothman, James E. The golgin family exhibits a propensity to form condensates in living cells. Febs Letters. 2020;594(19):3086-3094.