Anti GCC1 pAb (ATL-HPA019369 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA019369-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: GRIP and coiled-coil domain containing 1
Gene Name: GCC1
Alternative Gene Name: FLJ22035, GCC1P, GCC88, MGC20706
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029708: 93%, ENSRNOG00000007792: 93%
Entrez Gene ID: 79571
Uniprot ID: Q96CN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LELRLEETREALAGRAYAAEQMEGFELQTKQLTREVEELKSELQAIRDEKNQPDPRLQELQEEAARLKSHFQAQLQQEMR
Gene Sequence LELRLEETREALAGRAYAAEQMEGFELQTKQLTREVEELKSELQAIRDEKNQPDPRLQELQEEAARLKSHFQAQLQQEMR
Gene ID - Mouse ENSMUSG00000029708
Gene ID - Rat ENSRNOG00000007792
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GCC1 pAb (ATL-HPA019369 w/enhanced validation)
Datasheet Anti GCC1 pAb (ATL-HPA019369 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GCC1 pAb (ATL-HPA019369 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GCC1 pAb (ATL-HPA019369 w/enhanced validation)
Datasheet Anti GCC1 pAb (ATL-HPA019369 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GCC1 pAb (ATL-HPA019369 w/enhanced validation)
Citations for Anti GCC1 pAb (ATL-HPA019369 w/enhanced validation) – 1 Found
Ziltener, Pascal; Rebane, Aleksander A; Graham, Morven; Ernst, Andreas M; Rothman, James E. The golgin family exhibits a propensity to form condensates in living cells. Febs Letters. 2020;594(19):3086-3094.  PubMed