Anti GCC1 pAb (ATL-HPA019369 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019369-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GCC1
Alternative Gene Name: FLJ22035, GCC1P, GCC88, MGC20706
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029708: 93%, ENSRNOG00000007792: 93%
Entrez Gene ID: 79571
Uniprot ID: Q96CN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LELRLEETREALAGRAYAAEQMEGFELQTKQLTREVEELKSELQAIRDEKNQPDPRLQELQEEAARLKSHFQAQLQQEMR |
Gene Sequence | LELRLEETREALAGRAYAAEQMEGFELQTKQLTREVEELKSELQAIRDEKNQPDPRLQELQEEAARLKSHFQAQLQQEMR |
Gene ID - Mouse | ENSMUSG00000029708 |
Gene ID - Rat | ENSRNOG00000007792 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GCC1 pAb (ATL-HPA019369 w/enhanced validation) | |
Datasheet | Anti GCC1 pAb (ATL-HPA019369 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GCC1 pAb (ATL-HPA019369 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti GCC1 pAb (ATL-HPA019369 w/enhanced validation) | |
Datasheet | Anti GCC1 pAb (ATL-HPA019369 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GCC1 pAb (ATL-HPA019369 w/enhanced validation) |
Citations for Anti GCC1 pAb (ATL-HPA019369 w/enhanced validation) – 1 Found |
Ziltener, Pascal; Rebane, Aleksander A; Graham, Morven; Ernst, Andreas M; Rothman, James E. The golgin family exhibits a propensity to form condensates in living cells. Febs Letters. 2020;594(19):3086-3094. PubMed |